CATH Domain: 2o55A00 XML data for domain: 2o55A00

Molscript image for 2o55A00
2o55A00
PDB coordinates for domain 2o55A00

PDB 2o55, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.190 Phosphatidylinositol (PI) phosphodiesterase Gene3D
3.20.20.190.9
3.20.20.190.9.1
3.20.20.190.9.1.1
3.20.20.190.9.1.1.1
3.20.20.190.9.1.1.1.1

[top]
Segment boundaries for domain 2o55A00

Chopping figure for domain 2o55A00
DomainStart PDB ResidueStop PDB Residue
2o55A00 4 257

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.20.20.190.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2otdA01 82.87 Glycerophospholipid metabolismShigella flexneriGlycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]Glycerophosphodiester phosphodiesterase 3.20.20.190 222 24 85 2.68 3.14
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o55A00
SKVIIPKIVGHRGVGKEGLAPENTLRSFVLCERNIPYIETDLRVCKTGEIVLFHGTPEGTIPFYKDGTSRIGDLSLEELK
RLDVGGGHTIPSLEELFVAIEEQKFNLKLNLELKGEEWKRKESGDHQRLLLLVEKYHQERVDYCSFHHEALAHLKALCPD
VKITYLFNYGQPTPLDFVEQACYGDANGVSLFHYLTKEQVCTAHEKGLSVTVWPWIFDDSEEDWKKCLELQVDLICSNYP
FGLNFLSN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o55A00
SSKVIIPKIVGHRGVGKEGLAPENTLRSFVLCXERNIPYIETDLRVCKTGEIVLFHGTPEGTIPFYKDGTSRIGDLSLEE
LKRLDVGGGHTIPSLEELFVAIEEQKFNLKLNLELKGEEWKRKESGDHQRLLLLVEKYHXQERVDYCSFHHEALAHLKAL
CPDVKITYLFNYXGQPTPLDFVEQACYGDANGVSXLFHYLTKEQVCTAHEKGLSVTVWXPWIFDDSEEDWKKCLELQVDL
ICSNYPFGLXNFLSNISE
BLAST against CATH

[top]
Domain History Events (119)

Domain assigned by cuff on 15 Feb 2008 11:37

i agree - same superfamily

Domain scan prc pfamcath by auto on 25 Sep 2007 13:28

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 18 results for 2o55A00

Domain assignment manual match h by rupa on 03 Sep 2007 11:35

Very high ssap score, same fold. Unknown function of query domain 2o55A00

Homcheck review by rupa on 03 Sep 2007 11:35

Very high ssap score, same fold. Unknown function of query domain 2o55A00

Flow stage update by rupa on 03 Sep 2007 11:35

Very high ssap score, same fold. Unknown function of query domain 2o55A00

Homcheck allotment by rupa on 03 Sep 2007 11:33

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 11:33

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 19:21

Domain "2o55A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 19:21

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o55A00

Flow stage update by auto on 02 Sep 2007 19:15

Retrieved PRC_PFAMCATH results for job ID SID8049168059304735 and results inserted.

Update comment by auto on 02 Sep 2007 14:56

PRC_PFAMCATH job SID8049168059304735 is not yet finished.

Flow stage update by auto on 02 Sep 2007 14:52

The entry "2o55A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 02 Sep 2007 14:52

The entry "2o55A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 02 Sep 2007 14:29

Retrieved SSAP results for job ID SID4737896792912096 and results inserted.

Domain scan ssap cath by auto on 02 Sep 2007 14:28

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 431 results for 2o55A00

Update comment by auto on 31 Aug 2007 20:21

SSAP job SID4737896792912096 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:12

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:12

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:51

Giving up on SSAP job SID7363049001200624 because submission time of Tue Aug 28 14:55:16 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:51:47 2007).

Update comment by auto on 28 Aug 2007 15:02

SSAP job SID7363049001200624 is not yet finished.

Flow stage update by auto on 28 Aug 2007 14:55

The entry "2o55A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Aug 2007 14:55

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:20

Giving up on SSAP job SID9261019431167904 because submission time of Sun Aug 26 09:13:48 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:20:54 2007).

Update comment by auto on 26 Aug 2007 09:22

SSAP job SID9261019431167904 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:13

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:13

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 02:58

Giving up on SSAP job SID1191168576925664 because submission time of Thu Aug 23 22:36:30 2007 is more than 172800 seconds older than current time (Sun Aug 26 02:58:45 2007).

Update comment by auto on 23 Aug 2007 22:46

SSAP job SID1191168576925664 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:36

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:36

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:38

Giving up on SSAP job SID9553456032402224 because submission time of Tue Aug 21 10:58:04 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:38:59 2007).

Update comment by auto on 21 Aug 2007 11:38

SSAP job SID9553456032402224 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:58

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:58

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:19

Giving up on SSAP job SID0280556324770970 because submission time of Sun Aug 19 07:37:18 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:19:18 2007).

Update comment by auto on 19 Aug 2007 08:29

SSAP job SID0280556324770970 is not yet finished.

Flow stage update by auto on 19 Aug 2007 07:37

The entry "2o55A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 19 Aug 2007 07:37

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:37

Giving up on SSAP job SID0199183532646080 because submission time of Thu Aug 16 23:29:08 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:37:55 2007).

Update comment by auto on 17 Aug 2007 00:38

SSAP job SID0199183532646080 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:29

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:29

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:38

Giving up on SSAP job SID9478463396678836 because submission time of Tue Aug 14 09:09:40 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:38:04 2007).

Update comment by auto on 14 Aug 2007 10:38

SSAP job SID9478463396678836 is not yet finished.

Flow stage update by auto on 14 Aug 2007 09:09

The entry "2o55A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 09:09

The entry "2o55A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 06:49

Retrieved PRC results for job ID SID8789940113712352 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 06:48

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 2o55A00

Flow stage update by auto on 13 Aug 2007 10:43

The entry "2o55A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:43

The entry "2o55A00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 08:27

Retrieved HMM(SAM) results for job ID SID9874112660350136 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 08:26

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 7 results for 2o55A00

Update comment by auto on 12 Aug 2007 13:11

HMM(SAM) job SID9874112660350136 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:56

The entry "2o55A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:56

The entry "2o55A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 04:35

Retrieved "2o55A00" CATHEDRAL results for job ID SID8523208465716736 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 04:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2o55A00

Update comment by auto on 11 Aug 2007 05:58

"2o55A00" CATHEDRAL job SID8523208465716736 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 04:27

The entry "2o55A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 04:27

The entry "2o55A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:33

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o55A00.scanlist" for "2o55A00"

Write scan list by auto on 11 Aug 2007 02:33

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o55A00.scanlist" for domain "2o55A00"

Update comment by auto on 10 Aug 2007 14:32

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:45

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:14

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:58

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:58

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:52

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:43

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:42

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:05

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:51

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:57

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:46

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:33

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:15

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:44

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:56

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:50

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:37

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:50

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:44

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:22

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:18

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:15

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:05

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:23

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:14

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:51

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:07

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:11

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:10

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:00

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:10

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:57

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:53

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:50

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:01

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:03

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:02

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:47

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:31

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:25

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:06

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:05

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 03:04

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:45

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:34

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Aug 2007 19:10

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Aug 2007 19:04

No in_process hits for Domain "2o55A00" ready to be processed

Flow stage update by auto on 01 Aug 2007 19:03

NW result present for Domain "2o55A00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2o55A00"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2o55A00"

Insertion by cuff on 11 Jul 2007 16:03

nice chopping