CATH Domain: 2o3fA00 XML data for domain: 2o3fA00

Molscript image for 2o3fA00
2o3fA00
PDB coordinates for domain 2o3fA00

PDB 2o3f, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.10 "winged helix" repressor DNA binding domain Gene3D
1.10.10.10.24
1.10.10.10.24.1
1.10.10.10.24.1.1
1.10.10.10.24.1.1.1
1.10.10.10.24.1.1.1.1

[top]
Segment boundaries for domain 2o3fA00

Chopping figure for domain 2o3fA00
DomainStart PDB ResidueStop PDB Residue
2o3fA00 2 83

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.10.10.24.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hxiA01 77.41 Putative transcriptional regulatorStreptomyces coelicolor 1.10.10.60 63 6 75 3.16 4.19
3bqzA01 77.16 HTH-type transcriptional regulator qacRStaphylococcus aureus subsp. aureus Mu50 1.10.10.60 49 18 63 3.02 4.79
2vkvA01 75.13 Escherichia coliTetracycline repressor protein class DTetracycline repressor protein class B from transposon Tn10 1.10.10.60 61 4 71 3.29 4.62
1bl0A01 74.55 Multiple antibiotic resistance protein marAAraC family transcriptional regulator, multiple antibiotic resistance protein MarAEscherichia coli K-12 1.10.10.60 56 8 71 3.16 4.44
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o3fA00
ATGGLAIIQSHLPPSERKLADYILAHPHAIESTVNEISALANSSDAAVIRLCSLGLKGFQDLRVAGDLAKPTFQG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o3fA00
SNAXATGGLAIIQSXXHXLPPSERKLADYILAHPHXAIESTVNEISALANSSDAAVIRLCXSLGLKGFQDLXXRVAGDLA
KPTFQG
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 14 Feb 2008 18:28

Assigning to "1.10.10.10" based on similarity with "2o3fB00"

Flow stage update by auto on 14 Feb 2008 18:26

No in_process hits for Domain "2o3fA00" ready to be processed

Update comment by auto on 14 Feb 2008 18:24

Domain "2o3fA00" hits Domain "2o3fC00" (90.6976744186046% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2o3fA00" hits Domain "2o3fB00" (90.6976744186046% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2o3fA00" hits Domain "2o3fB00" (90.6976744186046% over 100%) which is currently in process

Update comment by auto on 27 Aug 2007 22:06

Domain "2o3fA00" hits Domain "2o3fB00" (90.6976744186046% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 22:05

Domain "2o3fA00" hits Domain "2o3fB00" (90.6976744186046% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 22:05

NW result present for Domain "2o3fA00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2o3fA00"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2o3fA00"

Insertion by auto on 16 Aug 2007 14:12

Final ChopClose added based on similarity with "2o3fB"