CATH Domain: 2o3aB00 XML data for domain: 2o3aB00

Molscript image for 2o3aB00
2o3aB00
PDB coordinates for domain 2o3aB00

PDB 2o3a, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.9
3.40.1280.10.9.1
3.40.1280.10.9.1.1
3.40.1280.10.9.1.1.1
3.40.1280.10.9.1.1.1.1

[top]
Segment boundaries for domain 2o3aB00

Chopping figure for domain 2o3aB00
DomainStart PDB ResidueStop PDB Residue
2o3aB00 1 167

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gz0B02 81.42 RRNA (guanosine-2'-O-)-methyltransferase activityEnzyme-directed rRNA 2'-O-methylationRNA methyltransferase, TrmH family [EC:2.1.1.-]Escherichia coli K-1223S rRNA (guanosine-2'-O-)-methyltransferase rlmB 3.40.1280.10 161 12 79 3.26 4.12
3dcmX00 79.25 Thermotoga maritimaUncharacterized protein TM_1570 3.40.1280.10 188 19 74 3.29 4.42
1k3rA01 79.19 Hypothetical proteinMethanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.1280.10 191 9 72 3.27 4.49
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o3aB00
LEVYVLRLGHRPERDKRISTHVALTARAFGAKGIYFDTEDKSVFESVRDVVERWGGDFFIKAVSWKKLLREFDGLKVHLT
MYGIPLPQKLEEIKRADKVLVVVGPPEVYELCDLNISIGTQPHSEVAALAVFLDRVLGKVFDISFDDAKIKVIPSERGKR
VVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o3aB00
MSLEVYVLRLGHRPERDKRISTHVALTARAFGAKGIYFDTEDKSVFESVRDVVERWGGDFFIKAVSWKKLLREFDGLKVH
LTMYGIPLPQKLEEIKRADKVLVVVGAEKVPPEVYELCDLNISIGTQPHSEVAALAVFLDRVLGKVFDISFDDAKIKVIP
SERGKRVVSEEGHHHHHH
BLAST against CATH

[top]
Domain History Events (74)

Domain assigned by cuff on 18 Feb 2008 14:57

same superfamily

Domain assignment manual match h by cuff on 18 Feb 2008 14:56

ample evidence for homology

Domain assignment manual match t by tronnberg on 12 Sep 2007 11:46

SSAP: 82.23 OV: 81 SEQ: 12. Similar linkage and structure (only difference is a small hair pin beta sheet). The query's function is unknown.

Homcheck review by tronnberg on 12 Sep 2007 11:46

SSAP: 82.23 OV: 81 SEQ: 12. Similar linkage and structure (only difference is a small hair pin beta sheet). The query's function is unknown.

Flow stage update by tronnberg on 12 Sep 2007 11:46

SSAP: 82.23 OV: 81 SEQ: 12. Similar linkage and structure (only difference is a small hair pin beta sheet). The query's function is unknown.

Homcheck allotment by tronnberg on 12 Sep 2007 11:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 12 Sep 2007 11:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 11 Sep 2007 19:58

Domain "2o3aB00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 11 Sep 2007 19:58

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o3aB00

Flow stage update by auto on 11 Sep 2007 19:20

Retrieved PRC_PFAMCATH results for job ID SID5456668949791600 and results inserted.

Domain scan prc pfamcath by auto on 11 Sep 2007 19:19

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 2o3aB00

Update comment by auto on 11 Sep 2007 15:54

PRC_PFAMCATH job SID5456668949791600 is not yet finished.

Prc pfamcath submit by auto on 11 Sep 2007 15:49

The entry "2o3aB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Sep 2007 15:49

The entry "2o3aB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Sep 2007 14:31

Retrieved SSAP results for job ID SID1742932664919366 and results inserted.

Domain scan ssap cath by auto on 11 Sep 2007 14:29

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1573 results for 2o3aB00

Update comment by auto on 09 Sep 2007 23:00

SSAP job SID1742932664919366 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:15

The entry "2o3aB00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:15

The entry "2o3aB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:46

Giving up on SSAP job SID1265572401066016 because submission time of Wed Sep 5 16:06:13 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:46:23 2007).

Update comment by auto on 05 Sep 2007 19:33

SSAP job SID1265572401066016 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:06

The entry "2o3aB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:06

The entry "2o3aB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 08:47

Retrieved PRC results for job ID SID1622495002799128 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 08:46

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2o3aB00

Prc cath submit by auto on 05 Sep 2007 03:44

The entry "2o3aB00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:44

The entry "2o3aB00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 17:31

Retrieved HMM(SAM) results for job ID SID2486313871363258 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 17:31

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2o3aB00

Update comment by auto on 04 Sep 2007 11:47

HMM(SAM) job SID2486313871363258 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:55

The entry "2o3aB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:55

The entry "2o3aB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 01:10

Retrieved "2o3aB00" CATHEDRAL results for job ID SID5439974430227200 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 01:08

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 586 results for 2o3aB00

Cathedral cath submit by auto on 03 Sep 2007 14:01

The entry "2o3aB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:01

The entry "2o3aB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:00

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o3aB00.scanlist" for "2o3aB00"

Write scan list by auto on 03 Sep 2007 12:00

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o3aB00.scanlist" for domain "2o3aB00"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:14

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:15

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:14

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:31

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:16

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:11

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:31

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:36

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:15

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:42

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:04

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:22

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:28

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:33

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:49

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:14

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:12

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:20

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:21

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Aug 2007 22:13

No satisfactory AssignClose result found.

Flow stage update by auto on 27 Aug 2007 22:05

No in_process hits for Domain "2o3aB00" ready to be processed

Flow stage update by auto on 27 Aug 2007 22:05

NW result present for Domain "2o3aB00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2o3aB00"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2o3aB00"

Insertion by auto on 16 Aug 2007 14:08

Final ChopClose added based on similarity with "2o3aA"