CATH Domain: 2o36A03 XML data for domain: 2o36A03

Molscript image for 2o36A03
2o36A03
PDB coordinates for domain 2o36A03

PDB 2o36, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.390 Collagenase (Catalytic Domain)
3.40.390.10 Collagenase (Catalytic Domain) Gene3D
3.40.390.10.11
3.40.390.10.11.1
3.40.390.10.11.1.1
3.40.390.10.11.1.1.1
3.40.390.10.11.1.1.1.1

[top]
Segment boundaries for domain 2o36A03

Chopping figure for domain 2o36A03
DomainStart PDB ResidueStop PDB Residue
2o36A01 24 151
2o36A02 152 360
2o36A02 512 677
2o36A03 361 511

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2o36A03
PVQVVTHGLLGIYQELLGLAFHHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREGKYGHAACFGLQPGCLRQDGS
RQIAIAAMVANFTKPTADAPSLLQHDEVRTYFHEFGHVMHQLCSQAEFAMFSGTHVETDFVEAPSQMLENW
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o36A03
PVQVVTHGLLGIYQELLGLAFHHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREGKYGHAACFGLQPGCLRQDGS
RQIAIAAMVANFTKPTADAPSLLQHDEVRTYFHEFGHVMHQLCSQAEFAMFSGTHVETDFVEAPSQMLENW
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Aug 2007 14:39

Assigning to "3.40.390.10" based on similarity with "1s4bP03"

Flow stage update by auto on 01 Aug 2007 14:35

No in_process hits for Domain "2o36A03" ready to be processed

Flow stage update by auto on 01 Aug 2007 14:35

NW result present for Domain "2o36A03"

Flow stage update by auto on 14 Jul 2007 06:02

All required files are present for Domain "2o36A03"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2o36A03"

Insertion by auto on 13 Jul 2007 13:48

Final ChopClose added based on similarity with "1s4bP"