CATH Domain: 2o2cA03 XML data for domain: 2o2cA03

Molscript image for 2o2cA03
2o2cA03
PDB coordinates for domain 2o2cA03

PDB 2o2c, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1390 Phosphoglucose isomerase, C-terminal domain
1.10.1390.10 Gene3D
1.10.1390.10.2
1.10.1390.10.2.1
1.10.1390.10.2.1.1
1.10.1390.10.2.1.1.1
1.10.1390.10.2.1.1.1.1

[top]
Segment boundaries for domain 2o2cA03

Chopping figure for domain 2o2cA03
DomainStart PDB ResidueStop PDB Residue
2o2cA01 43 186
2o2cA01 321 558
2o2cA02 187 320
2o2cA03 559 606

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1390.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2wu8A03 87.58 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismPentose phosphate pathwayGlycolysis / Gluconeogenesis 1.10.1390.10 45 31 81 1.97 2.42
2erlA00 75.46 Mating pheromone Er-1/Er-3Euplotes raikovi 1.20.50.10 40 2 68 2.41 3.51
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o2cA03
IDSYDQWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNELSH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o2cA03
IDSYDQWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNELSHLHHHHHH
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 03 Dec 2007 18:15

Assigning to "1.10.1390.10" based on similarity with "1t10A03"

Flow stage update by auto on 03 Dec 2007 18:04

No in_process hits for Domain "2o2cA03" ready to be processed

Flow stage update by auto on 03 Dec 2007 18:04

NW result present for Domain "2o2cA03"

Flow stage update by auto on 30 Nov 2007 10:15

All required files are present for Domain "2o2cA03"

Flow stage update by auto on 30 Nov 2007 05:16

Beginning processing for Domain "2o2cA03"

Insertion by auto on 30 Nov 2007 02:46

Final ChopClose added based on similarity with "2o2dC"