CATH Domain: 2o1qA01 XML data for domain: 2o1qA01

Molscript image for 2o1qA01
2o1qA01
PDB coordinates for domain 2o1qA01

PDB 2o1q, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.10 Jelly Rolls Gene3D
2.60.120.10.16
2.60.120.10.16.1
2.60.120.10.16.1.1
2.60.120.10.16.1.1.1
2.60.120.10.16.1.1.1.1

[top]
Segment boundaries for domain 2o1qA01

Chopping figure for domain 2o1qA01
DomainStart PDB ResidueStop PDB Residue
2o1qA01 18 144

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 2.60.120.10.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cjxA01 83.17 Ralstonia eutropha JMP134Putative uncharacterized protein 2.60.120.10 143 14 79 1.91 2.42
1vj2A00 82.04 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 114 17 79 2.64 3.34
1o4tA00 81.86 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 115 14 78 2.84 3.63
2pytA00 79.97 Ethanolamine utilization protein EutQSalmonella enterica subsp. enterica serovar TyphimuriumEthanolamine utilization protein eutQ 2.60.120.10 118 7 73 3.10 4.22
1j1lA01 78.93 PirinTranscription from RNA polymerase II promoterNucleusTranscription cofactor activityHomo sapiens 2.60.120.10 118 7 73 3.56 4.85
1pmiA03 77.81 Amino sugar and nucleotide sugar metabolismMannose-6-phosphate isomerase [EC:5.3.1.8]Mannose-6-phosphate isomeraseFructose and mannose metabolismMetabolic pathways 2.60.120.10 119 7 79 3.61 4.57
1y9qA02 77.80 Vibrio choleraeTranscriptional regulator, HTH_3 family 2.60.120.10 90 8 68 3.20 4.67
2q30A01 77.15 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 2.60.120.10 85 17 66 3.20 4.84
1qwrA02 76.88 Amino sugar and nucleotide sugar metabolismBacillus subtilisMannose-6-phosphate isomerase [EC:5.3.1.8]Putative mannose-6-phosphate isomerase yvyIFructose and mannose metabolism 2.60.120.10 86 8 66 2.69 4.07
3bcwA01 75.53 Bordetella bronchisepticaPutative uncharacterized protein 2.60.120.10 93 9 75 3.68 4.91
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o1qA01
WKPFPAAFSTGGIRWKLLHVSPEGSWTAIFDCPAGSSFAAHVHVGPGEYFLTKGKDVRGGKAAGGDTAIAPGYGYESANA
RHDKTEFPVASEFYSFLGPLTFVKPDGSPIAVIGWEDAQGAWAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o1qA01
WKPFPAAFSTGGIRWKLLHVSPEXGSWTAIFDCPAGSSFAAHVHVGPGEYFLTKGKXDVRGGKAAGGDTAIAPGYGYESA
NARHDKTEFPVASEFYXSFLGPLTFVKPDGSPIAVIGWEDAQGAWAA
BLAST against CATH

[top]
Domain History Events (54)

Domain assigned by cuff on 14 Feb 2008 17:57

I agree, same superfamily

Domain assignment manual match h by rupa on 10 Sep 2007 12:49

Very high ssap score, same fold. Unknown function, but suggest that score is high enough for homology.

Homcheck review by rupa on 10 Sep 2007 12:49

Very high ssap score, same fold. Unknown function, but suggest that score is high enough for homology.

Flow stage update by rupa on 10 Sep 2007 12:49

Very high ssap score, same fold. Unknown function, but suggest that score is high enough for homology.

Homcheck allotment by rupa on 10 Sep 2007 12:47

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 10 Sep 2007 12:47

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Sep 2007 23:52

Domain "2o1qA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Sep 2007 23:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o1qA01

Flow stage update by auto on 09 Sep 2007 23:42

Retrieved PRC_PFAMCATH results for job ID SID0285688001904288 and results inserted.

Domain scan prc pfamcath by auto on 09 Sep 2007 23:41

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 120 results for 2o1qA01

Update comment by auto on 09 Sep 2007 20:36

PRC_PFAMCATH job SID0285688001904288 is not yet finished.

Prc pfamcath submit by auto on 09 Sep 2007 20:30

The entry "2o1qA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Sep 2007 20:30

The entry "2o1qA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Sep 2007 19:38

Retrieved SSAP results for job ID SID3683509662056192 and results inserted.

Domain scan ssap cath by auto on 09 Sep 2007 19:35

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1248 results for 2o1qA01

Update comment by auto on 05 Sep 2007 19:33

SSAP job SID3683509662056192 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:05

The entry "2o1qA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:05

The entry "2o1qA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 08:39

Retrieved PRC results for job ID SID9517068762927488 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 08:38

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 37 results for 2o1qA01

Flow stage update by auto on 05 Sep 2007 03:43

The entry "2o1qA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:43

The entry "2o1qA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 17:24

Retrieved HMM(SAM) results for job ID SID9001229035078336 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 17:23

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2o1qA01

Update comment by auto on 04 Sep 2007 11:46

HMM(SAM) job SID9001229035078336 is not yet finished.

Flow stage update by auto on 04 Sep 2007 09:54

The entry "2o1qA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:54

The entry "2o1qA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 00:55

Retrieved "2o1qA01" CATHEDRAL results for job ID SID7764504799309312 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 00:53

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 297 results for 2o1qA01

Cathedral cath submit by auto on 03 Sep 2007 14:00

The entry "2o1qA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:00

The entry "2o1qA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:59

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o1qA01.scanlist" for "2o1qA01"

Write scan list by auto on 03 Sep 2007 11:59

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o1qA01.scanlist" for domain "2o1qA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:15

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:14

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:31

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 19:59

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2o1qA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2o1qA01"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2o1qA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2o1qA01"

Insertion by cuff on 23 Aug 2007 11:57

nice chopping