Domain assigned by cuff on 21 Feb 2008 14:11
i agree. same superfamily
CATH Domain: 2o14A02
2o14A02
PDB 2o14, Chain A, Domain 2
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.40
| 3-Layer(aba) Sandwich | |
 3.40.50
| Rossmann fold | |
 3.40.50.1110
| Gene3D | |
 3.40.50.1110.9
| ||
 3.40.50.1110.9.1
| ||
 3.40.50.1110.9.1.1
| ||
 3.40.50.1110.9.1.1.1
| ||
 3.40.50.1110.9.1.1.1.1
|
Segment boundaries for domain 2o14A02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2o14A01 | 14 | 161 |
| 2o14A02 | 162 | 367 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2o14A02 NRTIYVGGDSTVCNYYPLNSSKQAGWGQLPHYIDKHTFQVRNASGGQIARGFRNDGQLEAILKYIKPGDYFLQLGINDTN PKHKESEAEFKEVRDIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSI GPERTLGLYDGDTLHPNRAGADALARLAVQELKRQGIAGF
Domain History Events (58)
Domain assignment manual match h by rupa on 12 Sep 2007 11:36
Excellent ssap score, same fold and high sequence similarity.
Homcheck review by rupa on 12 Sep 2007 11:36
Excellent ssap score, same fold and high sequence similarity.
Flow stage update by rupa on 12 Sep 2007 11:36
Excellent ssap score, same fold and high sequence similarity.
Homcheck allotment by rupa on 12 Sep 2007 11:34
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 12 Sep 2007 11:34
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 11 Sep 2007 19:56
Domain "2o14A02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 11 Sep 2007 19:55
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o14A02
Flow stage update by auto on 11 Sep 2007 19:17
Retrieved PRC_PFAMCATH results for job ID SID6711207996731024 and results inserted.
Domain scan prc pfamcath by auto on 11 Sep 2007 19:16
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 13 results for 2o14A02
Update comment by auto on 11 Sep 2007 15:54
PRC_PFAMCATH job SID6711207996731024 is not yet finished.
Prc pfamcath submit by auto on 11 Sep 2007 15:49
The entry "2o14A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 15:49
The entry "2o14A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 14:26
Retrieved SSAP results for job ID SID2384078868870292 and results inserted.
Domain scan ssap cath by auto on 11 Sep 2007 14:23
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1238 results for 2o14A02
Update comment by auto on 09 Sep 2007 23:00
SSAP job SID2384078868870292 is not yet finished.
Flow stage update by auto on 09 Sep 2007 22:15
The entry "2o14A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Sep 2007 22:15
The entry "2o14A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:33
Giving up on SSAP job SID4161187495049898 because submission time of Wed Sep 5 16:04:54 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:33:14 2007).
Update comment by auto on 05 Sep 2007 19:32
SSAP job SID4161187495049898 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:04
The entry "2o14A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:04
The entry "2o14A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 08:37
Retrieved PRC results for job ID SID2868610773214440 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 08:36
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 2o14A02
Prc cath submit by auto on 05 Sep 2007 03:43
The entry "2o14A02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:43
The entry "2o14A02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 17:22
Retrieved HMM(SAM) results for job ID SID5829970029884960 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 17:20
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 2o14A02
Update comment by auto on 04 Sep 2007 11:46
HMM(SAM) job SID5829970029884960 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:53
The entry "2o14A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:53
The entry "2o14A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 00:50
Retrieved "2o14A02" CATHEDRAL results for job ID SID0227479231275520 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 00:48
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 465 results for 2o14A02
Cathedral cath submit by auto on 03 Sep 2007 14:00
The entry "2o14A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:00
The entry "2o14A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:59
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o14A02.scanlist" for "2o14A02"
Write scan list by auto on 03 Sep 2007 11:58
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o14A02.scanlist" for domain "2o14A02"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:59
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2o14A02" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2o14A02"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2o14A02"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2o14A02"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
