Domain assigned by cuff on 21 Feb 2008 10:39
same superfamily
CATH Domain: 2o14A01
2o14A01
PDB 2o14, Chain A, Domain 1
| CATH Code | Level Description | Links |
|---|---|---|
 2
| Mainly Beta | |
 2.60
| Sandwich | |
 2.60.120
| Jelly Rolls | |
 2.60.120.360
| Gene3D | |
 2.60.120.360.3
| ||
 2.60.120.360.3.1
| ||
 2.60.120.360.3.1.1
| ||
 2.60.120.360.3.1.1.1
| ||
 2.60.120.360.3.1.1.1.1
|
Segment boundaries for domain 2o14A01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2o14A01 | 14 | 161 |
| 2o14A02 | 162 | 367 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2o14A01 KVYQFDFGSGSEPGYIGVRASDRYDRSKGYGFQTPENRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTL GNTARASVAAEGVFQVINTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVT
Domain History Events (55)
Domain assignment manual match h by cuff on 21 Feb 2008 10:37
SCOP places in same superfamily, nice structural comparison. Top hit not in same SCOP superfamily as query
Domain assignment manual match t by tronnberg on 10 Sep 2007 12:37
SSAP: 75.34 OV: 82 SEQ: 6. Similar linkage and structure. The function for the query is unknown.
Homcheck review by tronnberg on 10 Sep 2007 12:37
SSAP: 75.34 OV: 82 SEQ: 6. Similar linkage and structure. The function for the query is unknown.
Flow stage update by tronnberg on 10 Sep 2007 12:37
SSAP: 75.34 OV: 82 SEQ: 6. Similar linkage and structure. The function for the query is unknown.
Homcheck allotment by tronnberg on 10 Sep 2007 12:35
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Sep 2007 12:35
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Sep 2007 20:44
Domain "2o14A01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Sep 2007 20:43
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o14A01
Flow stage update by auto on 09 Sep 2007 20:35
Retrieved PRC_PFAMCATH results for job ID SID2177361952750368 and results inserted.
Domain scan prc pfamcath by auto on 09 Sep 2007 20:34
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2o14A01
Update comment by auto on 09 Sep 2007 15:38
PRC_PFAMCATH job SID2177361952750368 is not yet finished.
Flow stage update by auto on 09 Sep 2007 15:34
The entry "2o14A01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 09 Sep 2007 15:34
The entry "2o14A01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Sep 2007 14:39
Retrieved SSAP results for job ID SID9663088063681088 and results inserted.
Domain scan ssap cath by auto on 09 Sep 2007 14:36
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 997 results for 2o14A01
Update comment by auto on 05 Sep 2007 19:32
SSAP job SID9663088063681088 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:04
The entry "2o14A01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:04
The entry "2o14A01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 08:36
Retrieved PRC results for job ID SID3516516711352544 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 08:35
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2o14A01
Prc cath submit by auto on 05 Sep 2007 03:42
The entry "2o14A01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:42
The entry "2o14A01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 17:20
Retrieved HMM(SAM) results for job ID SID3701656162681856 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 17:19
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2o14A01
Update comment by auto on 04 Sep 2007 11:46
HMM(SAM) job SID3701656162681856 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:53
The entry "2o14A01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:53
The entry "2o14A01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 00:48
Retrieved "2o14A01" CATHEDRAL results for job ID SID4114001118313360 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 00:47
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 293 results for 2o14A01
Cathedral cath submit by auto on 03 Sep 2007 13:59
The entry "2o14A01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:59
The entry "2o14A01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:58
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o14A01.scanlist" for "2o14A01"
Write scan list by auto on 03 Sep 2007 11:58
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o14A01.scanlist" for domain "2o14A01"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:59
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2o14A01" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2o14A01"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2o14A01"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2o14A01"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
