Domain assigned by cuff on 21 Feb 2008 10:39
same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
2
| Mainly Beta | |
2.60
| Sandwich | |
2.60.120
| Jelly Rolls | |
2.60.120.360
| Gene3D | |
2.60.120.360.3
| ||
2.60.120.360.3.1
| ||
2.60.120.360.3.1.1
| ||
2.60.120.360.3.1.1.1
| ||
2.60.120.360.3.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2o14A01 | 14 | 161 |
| 2o14A02 | 162 | 367 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|2o14A01 KVYQFDFGSGSEPGYIGVRASDRYDRSKGYGFQTPENRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTL GNTARASVAAEGVFQVINTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVT
same superfamily
SCOP places in same superfamily, nice structural comparison. Top hit not in same SCOP superfamily as query
SSAP: 75.34 OV: 82 SEQ: 6. Similar linkage and structure. The function for the query is unknown.
SSAP: 75.34 OV: 82 SEQ: 6. Similar linkage and structure. The function for the query is unknown.
SSAP: 75.34 OV: 82 SEQ: 6. Similar linkage and structure. The function for the query is unknown.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2o14A01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o14A01
Retrieved PRC_PFAMCATH results for job ID SID2177361952750368 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2o14A01
PRC_PFAMCATH job SID2177361952750368 is not yet finished.
The entry "2o14A01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2o14A01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID9663088063681088 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 997 results for 2o14A01
SSAP job SID9663088063681088 is not yet finished.
The entry "2o14A01" has been submitted to the SSAP webservice.
The entry "2o14A01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID3516516711352544 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2o14A01
The entry "2o14A01" has been submitted to the PRC webservice.
The entry "2o14A01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID3701656162681856 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2o14A01
HMM(SAM) job SID3701656162681856 is not yet finished.
The entry "2o14A01" has been submitted to the HMM (SAM) webservice.
The entry "2o14A01" has been submitted to the HMM (SAM) webservice.
Retrieved "2o14A01" CATHEDRAL results for job ID SID4114001118313360 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 293 results for 2o14A01
The entry "2o14A01" has been submitted to the CATHEDRAL webservice.
The entry "2o14A01" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o14A01.scanlist" for "2o14A01"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o14A01.scanlist" for domain "2o14A01"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2o14A01" ready to be processed
NW result present for Domain "2o14A01"
All required files are present for Domain "2o14A01"
Beginning processing for Domain "2o14A01"
nice chopping