CATH Domain: 2o0yB02 XML data for domain: 2o0yB02

Molscript image for 2o0yB02
2o0yB02
PDB coordinates for domain 2o0yB02

PDB 2o0y, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.9
3.30.450.40.9.1
3.30.450.40.9.1.1
3.30.450.40.9.1.1.1
3.30.450.40.9.1.1.1.1

[top]
Segment boundaries for domain 2o0yB02

Chopping figure for domain 2o0yB02
DomainStart PDB ResidueStop PDB Residue
2o0yB01 17 81
2o0yB02 84 260

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.450.40.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ia2A02 87.72 Rhodococcus sp. DK17PcaR 3.30.450.40 179 20 94 4.08 4.30
3d3oA00 85.80 Putative transcriptional regulator (IcIR family)Acinetobacter sp. ADP1 3.30.450.40 167 16 90 3.53 3.88
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2o0yB02
RWVRLAGRTWAPPEEVVDIRQLSADTGETVNLYIRQGLSRVVVAQCESTATVRSVIPLGVPYPLWAGAAGKILLLAAPEL
IDDVAADSPHGPEFADQLREKVEDGRERGYQLVHGERELGSSGLSFPLVDSHGTVVAALTLGGPTGRFTEDRTPHYIECT
RAAAEEISAIGLPGLD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2o0yB02
RWVRLAGRTWAPPEEVVDIXRQLSADTGETVNLYIRQGLSRVVVAQCESTATVRSVIPLGVPYPLWAGAAGKILLLAAPE
LIDDVAADSPHGPEFADQLREKVEDGRERGYQLVHGERELGSSGLSFPLVDSHGTVVAALTLGGPTGRFTEDRTPHYIEC
TRAAAEEISAIGLPGLD
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 08 Mar 2008 17:24

Assigning to "3.30.450.40" based on similarity with "2o0yD02"

Flow stage update by auto on 08 Mar 2008 17:21

No in_process hits for Domain "2o0yB02" ready to be processed

Update comment by auto on 08 Mar 2008 17:09

Domain "2o0yB02" hits Domain "2o0yA02" (99.4350282485876% over 97.7900552486188%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2o0yB02" hits Domain "2o0yD02" (99.4350282485876% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2o0yB02" hits Domain "2o0yD02" (99.4350282485876% over 100%) which is currently in process

Update comment by auto on 27 Aug 2007 18:05

Domain "2o0yB02" hits Domain "2o0yD02" (99.4350282485876% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 18:04

Domain "2o0yB02" hits Domain "2o0yD02" (99.4350282485876% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 18:04

NW result present for Domain "2o0yB02"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2o0yB02"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2o0yB02"

Insertion by auto on 20 Aug 2007 14:28

Final ChopClose added based on similarity with "2o0yD"