Domain assigned by cuff on 10 Apr 2008 16:55
same superfamily
CATH Domain: 2o0mA00
2o0mA00
PDB 2o0m, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.40
| 3-Layer(aba) Sandwich | |
 3.40.50
| Rossmann fold | |
 3.40.50.1360
| Gene3D | |
 3.40.50.1360.3
| ||
 3.40.50.1360.3.1
| ||
 3.40.50.1360.3.1.1
| ||
 3.40.50.1360.3.1.1.1
| ||
 3.40.50.1360.3.1.1.1.1
|
Structural Neighbourhood (3 entries)
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.1360.3.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 3 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
2r5fA00 | 82.85 | 3.40.50.1360 | 213 | 23 | 86 | 3.13 | 3.62 | |
|
2gnpA00 | 82.68 | 3.40.50.1360 | 257 | 19 | 89 | 3.21 | 3.57 | |
|
1y89A00 | 76.19 | 3.40.50.1360 | 232 | 9 | 75 | 3.74 | 4.93 |
[1]
Displaying entries 1 to 3 (page 1 of 1)
Domain ATOM Sequence
>pdb|2o0mA00 HQIEKETQYFGIQRCIVVAGDSDIQKKVLSDFGDVLTNTLNLLLPNGENTIAVGGTTAVAENGSLETEKRHNLFVPARGG IGEAVSVQANSISAVANKTGGNYRALYVPEQLSRETYNSLLQEPSIQEVLTLISHANCVVHSIGRALHAARRKSDDEVLK QKNAVAESFGYFFDEEGKVVYKIPRIGLQLKNLQEIPYVVAIAGGKTKAKAIRAYKNAPKQTWLITDEAAANEILK
Domain History Events (75)
Domain assignment manual match h by cuff on 10 Apr 2008 16:54
great structural match, same family in scop
Domain assignment manual match a by tronnberg on 12 Sep 2007 11:25
SSAP: 74.27 OV: 71 SEQ: 8. Similar overal structure, but there are a few secondary structual differences. None of the matches in the ScanList with a SSAP score above 70 has the same function as the query. I believe that 2gnpA00 (TBA) should be assigned to the same topology as the query (SSAP: 82.68 OV: 89 SEQ: 19)
Homcheck review by tronnberg on 12 Sep 2007 11:25
SSAP: 74.27 OV: 71 SEQ: 8. Similar overal structure, but there are a few secondary structual differences. None of the matches in the ScanList with a SSAP score above 70 has the same function as the query. I believe that 2gnpA00 (TBA) should be assigned to the same topology as the query (SSAP: 82.68 OV: 89 SEQ: 19)
Flow stage update by tronnberg on 12 Sep 2007 11:25
SSAP: 74.27 OV: 71 SEQ: 8. Similar overal structure, but there are a few secondary structual differences. None of the matches in the ScanList with a SSAP score above 70 has the same function as the query. I believe that 2gnpA00 (TBA) should be assigned to the same topology as the query (SSAP: 82.68 OV: 89 SEQ: 19)
Homcheck allotment by tronnberg on 12 Sep 2007 11:16
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 12 Sep 2007 11:16
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 11 Sep 2007 19:52
Domain "2o0mA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 11 Sep 2007 19:52
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2o0mA00
Flow stage update by auto on 11 Sep 2007 19:13
Retrieved PRC_PFAMCATH results for job ID SID2175584398628320 and results inserted.
Domain scan prc pfamcath by auto on 11 Sep 2007 19:12
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 2o0mA00
Update comment by auto on 11 Sep 2007 15:53
PRC_PFAMCATH job SID2175584398628320 is not yet finished.
Flow stage update by auto on 11 Sep 2007 15:48
The entry "2o0mA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 11 Sep 2007 15:48
The entry "2o0mA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 14:20
Retrieved SSAP results for job ID SID9768195221347432 and results inserted.
Domain scan ssap cath by auto on 11 Sep 2007 14:18
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 550 results for 2o0mA00
Update comment by auto on 09 Sep 2007 23:00
SSAP job SID9768195221347432 is not yet finished.
Flow stage update by auto on 09 Sep 2007 22:14
The entry "2o0mA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Sep 2007 22:14
The entry "2o0mA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:28
Giving up on SSAP job SID6058581361361536 because submission time of Wed Sep 5 16:03:35 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:28:28 2007).
Update comment by auto on 05 Sep 2007 19:32
SSAP job SID6058581361361536 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:03
The entry "2o0mA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:03
The entry "2o0mA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 08:27
Retrieved PRC results for job ID SID1958201632761118 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 08:26
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2o0mA00
Flow stage update by auto on 05 Sep 2007 03:41
The entry "2o0mA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:41
The entry "2o0mA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 17:11
Retrieved HMM(SAM) results for job ID SID1420697014338648 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 17:10
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2o0mA00
Update comment by auto on 04 Sep 2007 11:45
HMM(SAM) job SID1420697014338648 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:52
The entry "2o0mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:52
The entry "2o0mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 00:30
Retrieved "2o0mA00" CATHEDRAL results for job ID SID3926858508093776 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 00:27
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 458 results for 2o0mA00
Flow stage update by auto on 03 Sep 2007 13:59
The entry "2o0mA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 13:58
The entry "2o0mA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:57
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2o0mA00.scanlist" for "2o0mA00"
Write scan list by auto on 03 Sep 2007 11:57
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2o0mA00.scanlist" for domain "2o0mA00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:16
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:36
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:15
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:42
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:22
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:28
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:32
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:49
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:14
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:11
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:20
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:21
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:13
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 27 Aug 2007 18:11
No satisfactory AssignClose result found.
Flow stage update by auto on 27 Aug 2007 18:04
No in_process hits for Domain "2o0mA00" ready to be processed
Flow stage update by auto on 27 Aug 2007 18:04
NW result present for Domain "2o0mA00"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2o0mA00"
Flow stage update by auto on 16 Aug 2007 17:14
Beginning processing for Domain "2o0mA00"
Insertion by cuff on 16 Aug 2007 14:05
nice chopping
