Domain assigned by auto on 01 Aug 2007 10:30
Assigning to "2.40.50.140" based on similarity with "1gd7A00"
There are 7 matching structural neighberhood comparisons for CATH ID 2.40.50.140.4.1.1.1.1 (SIMAX score < 5)
>pdb|2nzhB00 VIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEV LVLGGIPGQGDVVLLQPDQPVPNGTKIG
Assigning to "2.40.50.140" based on similarity with "1gd7A00"
No in_process hits for Domain "2nzhB00" ready to be processed
NW result present for Domain "2nzhB00"
All required files are present for Domain "2nzhB00"
Beginning processing for Domain "2nzhB00"
Final ChopClose added based on similarity with "1gd7A"