CATH Domain: 2nyvA02 XML data for domain: 2nyvA02

Molscript image for 2nyvA02
2nyvA02
PDB coordinates for domain 2nyvA02

PDB 2nyv, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.240 Putative phosphatase; domain 2 Gene3D
1.10.150.240.21
1.10.150.240.21.1
1.10.150.240.21.1.1
1.10.150.240.21.1.1.1
1.10.150.240.21.1.1.1.1

Segment boundaries for domain 2nyvA02

Chopping figure for domain 2nyvA02
DomainStart PDB ResidueStop PDB Residue
2nyvA01 2 17
2nyvA01 82 217
2nyvA02 18 81

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.150.240.21.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2i7dA02 79.59 Pyrimidine metabolism5'(3')-deoxyribonucleotidase, cytosolic typePurine metabolismDephosphorylationNucleus 1.10.40.40 55 14 84 3.52 4.17
1rykA00 75.16 UPF0337 protein yjbJProtein bindingEscherichia coli K-12 1.10.1470.10 69 4 75 3.73 4.95
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2nyvA02
AKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVY    

Domain COMBS Sequence

>pdb|2nyvA02
AKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVY    

Domain History Events (121)

Domain assigned by cuff on 14 Feb 2008 13:35

i agree. same superfamily

Domain assignment manual match h by rupa on 03 Sep 2007 11:33

High ssap score, same fold and function

Homcheck review by rupa on 03 Sep 2007 11:33

High ssap score, same fold and function

Flow stage update by rupa on 03 Sep 2007 11:33

High ssap score, same fold and function

Homcheck allotment by rupa on 03 Sep 2007 11:26

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 03 Sep 2007 11:26

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 05:41

Domain "2nyvA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 05:40

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nyvA02

Flow stage update by auto on 02 Sep 2007 03:44

Retrieved PRC_PFAMCATH results for job ID SID9280725419375268 and results inserted.

Domain scan prc pfamcath by auto on 02 Sep 2007 03:44

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2nyvA02

Update comment by auto on 01 Sep 2007 14:58

PRC_PFAMCATH job SID9280725419375268 is not yet finished.

Flow stage update by auto on 01 Sep 2007 14:55

The entry "2nyvA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 01 Sep 2007 14:55

The entry "2nyvA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 01 Sep 2007 14:38

Retrieved SSAP results for job ID SID3863729169929440 and results inserted.

Domain scan ssap cath by auto on 01 Sep 2007 14:35

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2230 results for 2nyvA02

Update comment by auto on 31 Aug 2007 20:20

SSAP job SID3863729169929440 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:11

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:11

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:51

Giving up on SSAP job SID5590616278797906 because submission time of Tue Aug 28 14:54:50 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:51:29 2007).

Update comment by auto on 28 Aug 2007 15:02

SSAP job SID5590616278797906 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:54

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:54

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:20

Giving up on SSAP job SID0305138146689920 because submission time of Sun Aug 26 09:13:23 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:20:26 2007).

Update comment by auto on 26 Aug 2007 09:22

SSAP job SID0305138146689920 is not yet finished.

Flow stage update by auto on 26 Aug 2007 09:13

The entry "2nyvA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 26 Aug 2007 09:13

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 02:58

Giving up on SSAP job SID8797315837671792 because submission time of Thu Aug 23 22:36:10 2007 is more than 172800 seconds older than current time (Sun Aug 26 02:58:23 2007).

Update comment by auto on 23 Aug 2007 22:46

SSAP job SID8797315837671792 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:36

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:36

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:38

Giving up on SSAP job SID6223886386054464 because submission time of Tue Aug 21 10:57:44 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:38:40 2007).

Update comment by auto on 21 Aug 2007 11:38

SSAP job SID6223886386054464 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:57

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:57

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:18

Giving up on SSAP job SID4019064208868290 because submission time of Sun Aug 19 07:36:52 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:18:52 2007).

Update comment by auto on 19 Aug 2007 08:29

SSAP job SID4019064208868290 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:36

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:36

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:37

Giving up on SSAP job SID7504884966496832 because submission time of Thu Aug 16 23:28:45 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:37:35 2007).

Update comment by auto on 17 Aug 2007 00:38

SSAP job SID7504884966496832 is not yet finished.

Flow stage update by auto on 16 Aug 2007 23:28

The entry "2nyvA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Aug 2007 23:28

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:37

Giving up on SSAP job SID2171306321970112 because submission time of Tue Aug 14 09:09:00 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:37:45 2007).

Update comment by auto on 14 Aug 2007 10:38

SSAP job SID2171306321970112 is not yet finished.

Flow stage update by auto on 14 Aug 2007 09:09

The entry "2nyvA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 09:09

The entry "2nyvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 06:45

Retrieved PRC results for job ID SID4922674057154176 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 06:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2nyvA02

Flow stage update by auto on 13 Aug 2007 10:42

The entry "2nyvA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:42

The entry "2nyvA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 08:22

Retrieved HMM(SAM) results for job ID SID7264554393422024 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 08:21

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2nyvA02

Update comment by auto on 12 Aug 2007 13:10

HMM(SAM) job SID7264554393422024 is not yet finished.

Flow stage update by auto on 12 Aug 2007 11:55

The entry "2nyvA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 12 Aug 2007 11:55

The entry "2nyvA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 04:29

Retrieved "2nyvA02" CATHEDRAL results for job ID SID2319688677189568 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 04:28

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 61 results for 2nyvA02

Update comment by auto on 11 Aug 2007 05:58

"2nyvA02" CATHEDRAL job SID2319688677189568 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 04:26

The entry "2nyvA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 04:26

The entry "2nyvA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:32

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nyvA02.scanlist" for "2nyvA02"

Write scan list by auto on 11 Aug 2007 02:32

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nyvA02.scanlist" for domain "2nyvA02"

Update comment by auto on 10 Aug 2007 14:32

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:45

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:14

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:58

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:58

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:45

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:51

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:43

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:42

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:05

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:51

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:57

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:46

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:33

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:14

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:44

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:56

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:50

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:37

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:50

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:44

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:22

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:17

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:15

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:05

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:22

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:13

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:51

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:07

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:10

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:10

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:00

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:09

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:57

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:53

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:49

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:01

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:03

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:02

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:47

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:31

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:25

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:06

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:05

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 03:04

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:44

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:34

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:07

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:58

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Aug 2007 10:29

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Aug 2007 10:26

No in_process hits for Domain "2nyvA02" ready to be processed

Flow stage update by auto on 01 Aug 2007 10:26

NW result present for Domain "2nyvA02"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2nyvA02"

Flow stage update by auto on 11 Jul 2007 16:04

Beginning processing for Domain "2nyvA02"

Insertion by cuff on 11 Jul 2007 16:03

nice chopping