CATH Domain: 2nyiA02 XML data for domain: 2nyiA02

Molscript image for 2nyiA02
2nyiA02
PDB coordinates for domain 2nyiA02

PDB 2nyi, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.260 Gene3D
3.30.70.260.7
3.30.70.260.7.1
3.30.70.260.7.1.1
3.30.70.260.7.1.1.1
3.30.70.260.7.1.1.1.1

[top]
Segment boundaries for domain 2nyiA02

Chopping figure for domain 2nyiA02
DomainStart PDB ResidueStop PDB Residue
2nyiA01 2 82
2nyiA02 87 176

Structural Neighbourhood (39 entries)

There are 39 matching structural neighberhood comparisons for CATH ID 3.30.70.260.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 39 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1u8sA01 89.43 Glycine cleavage system transcriptional repressor, putativeGlycine cleavage system transcriptional repressorVibrio cholerae 3.30.70.260 86 15 91 1.36 1.49
1u8sA02 88.40 Glycine cleavage system transcriptional repressor, putativeGlycine cleavage system transcriptional repressorVibrio cholerae 3.30.70.260 84 16 91 1.88 2.07
2qmxA03 83.58 Prephenate dehydratase [EC:4.2.1.51]Phenylalanine, tyrosine and tryptophan biosynthesisChlorobaculum tepidumMetabolic pathwaysPrephenate dehydratase 3.30.70.260 90 7 90 3.57 3.97
1jqgA01 82.78 Carboxypeptidase AHelicoverpa armigera 3.30.70.340 91 10 75 2.51 3.31
2nzcA00 81.51 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 11 83 2.71 3.26
1rwuA00 81.49 Hypothetical proteinUPF0250 protein ybeDEscherichia coli K-12 3.30.70.1460 87 8 87 3.63 4.14
1xmbA02 81.42 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.30.70.360 101 6 75 2.21 2.94
2qmwA03 81.26 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysPrephenate dehydratase [EC:4.2.1.51]Similar to chorismate mutaseStaphylococcus aureus subsp. aureus Mu50 3.30.70.260 73 12 80 2.70 3.34
1vr6A01 80.53 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysThermotoga maritima3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]Phospho-2-dehydro-3-deoxyheptonate aldolase 3.30.70.1140 75 5 79 2.96 3.71
2hiyB01 79.97 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.1280 87 14 82 2.99 3.65
1nsaA01 79.97 Sus scrofaCarboxypeptidase B [EC:3.4.17.2]Carboxypeptidase B 3.30.70.340 92 6 75 2.75 3.67
2epiB00 79.45 Methanocaldococcus jannaschiiUPF0045 protein MJ1052 3.30.70.930 96 7 77 2.57 3.33
2rb7A02 79.43 Peptidase, M20/M25/M40 familyDesulfovibrio desulfuricans subsp. desulfuricans str. G20 3.30.70.360 98 6 71 3.07 4.30
1s99A02 78.65 Bacillus subtilisPutative HMP/thiamine-binding protein ykoF 3.30.70.930 81 7 80 2.86 3.54
1q5yD00 78.34 CopG family transcriptional regulator, nickel-responsive regulatorNickel-responsive regulatorProtein bindingEscherichia coli K-12 3.30.70.1150 80 3 80 3.02 3.73
3cedA00 78.31 ABC transportersD-methionine transport system ATP-binding proteinMethionine import ATP-binding protein MetN 2Staphylococcus aureus subsp. aureus Mu50 3.30.70.260 97 10 76 3.09 4.05
2fgcA03 78.17 Butanoate metabolismC5-Branched dibasic acid metabolismPantothenate and CoA biosynthesisValine, leucine and isoleucine biosynthesisMetabolic pathways 3.30.70.1150 74 6 69 3.08 4.42
1z2lA02 78.04 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.30.70.360 115 11 73 3.47 4.75
1ufwA00 77.58 Phosphatidylinositol signaling systemSynaptojanin-2Phosphatidylinositol-bisphosphatase [EC:3.1.3.36]Homo sapiensInositol phosphate metabolism 3.30.70.330 95 11 77 3.78 4.85
1eayD00 77.45 Bacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Escherichia coli K-12Chemotaxis protein cheA 3.30.70.400 69 13 76 3.42 4.48
1kn6A00 77.22 Mus musculusPeptide hormone processingSerine-type endopeptidase activityNeuroendocrine convertase 1Proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93] 3.30.70.850 73 16 75 3.48 4.62
2rhsD06 76.87 Aminoacyl-tRNA biosynthesisStaphylococcus haemolyticus JCSC1435Phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]Phenylalanyl-tRNA synthetase beta chain 3.30.70.380 88 5 83 3.87 4.65
2ia0B02 76.83 Pyrococcus furiosusUncharacterized HTH-type transcriptional regulator PF0864 3.30.70.920 99 5 75 2.89 3.81
1in0A01 76.65 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 10 76 3.62 4.74
1vk8A00 76.62 Thermotoga maritimaPutative uncharacterized protein 3.30.70.930 91 11 73 2.97 4.03
1vgyA02 76.49 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.30.70.360 114 16 71 3.55 5.00
2dgsA01 76.19 CytoplasmDAZ-associated protein 1NucleusRNA bindingHomo sapiens 3.30.70.330 89 4 82 3.82 4.66
1l3kA02 76.08 Heterogeneous nuclear ribonucleoprotein A1NucleolusProtein bindingCytoplasmSpliceosome 3.30.70.330 78 8 78 3.72 4.73
1d8zA00 75.90 Mus musculusAU-rich element bindingELAV like protein 2/3/4ELAV-like protein 3 3.30.70.330 89 4 82 3.64 4.44
2iboA00 75.84 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.930 87 5 78 3.40 4.32
1s99A01 75.84 Bacillus subtilisPutative HMP/thiamine-binding protein ykoF 3.30.70.930 77 5 78 2.98 3.79
2x3dF01 75.54 Hypothetical proteinSulfolobus solfataricusPutative uncharacterized protein 3.30.70.1340 84 16 83 3.94 4.74
1yqhB00 75.46 IG hypothetical 16092Bacillus cereus ATCC 14579 3.30.70.930 98 10 72 2.88 3.98
1jx4A02 74.83 DNA polymerase IV (archaeal DinB-like DNA polymerase) [EC:2.7.7.7]DNA polymerase IVSulfolobus solfataricus 3.30.70.270 96 5 72 3.15 4.32
1gmuA01 74.79 Klebsiella aerogenesUrease accessory protein ureE 3.30.70.790 67 4 67 3.27 4.85
2vqeJ00 74.57 RibosomeThermus thermophilus HB8Small subunit ribosomal protein S1030S ribosomal protein S10 3.30.70.600 98 10 72 3.31 4.57
2pd1A01 74.39 Nitrosomonas europaeaPutative uncharacterized protein 3.30.70.900 93 7 84 3.76 4.43
1b7yB06 73.50 Aminoacyl-tRNA biosynthesisPhenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]Phenylalanyl-tRNA synthetase beta chainThermus thermophilus 3.30.70.380 86 11 84 4.15 4.92
1q8kA03 70.55 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 subunit 1PolysomeHomo sapiens 3.30.70.1130 116 4 62 2.98 4.74
[1]
Displaying entries 1 to 39 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2nyiA02
VSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRGSRVAFPFPLYQEVVTALSRVEEEFG
VDIDLEEVV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nyiA02
VSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRXGSRVAFPFPLYQEVVTALSRVEEEF
GVDIDLEEVV
BLAST against CATH

[top]
Domain History Events (55)

Domain assigned by cuff on 14 Feb 2008 15:53

same superfamily

Domain assignment manual match h by cuff on 14 Feb 2008 15:52

def homologous

Domain assignment manual match t by tronnberg on 10 Sep 2007 12:28

SSAP: 89.43 OV: 91 SEQ: 15. Very similar linkage and structure. The query's function is unknown.

Homcheck review by tronnberg on 10 Sep 2007 12:28

SSAP: 89.43 OV: 91 SEQ: 15. Very similar linkage and structure. The query's function is unknown.

Flow stage update by tronnberg on 10 Sep 2007 12:28

SSAP: 89.43 OV: 91 SEQ: 15. Very similar linkage and structure. The query's function is unknown.

Homcheck allotment by tronnberg on 10 Sep 2007 12:27

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Sep 2007 12:27

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Sep 2007 11:51

Domain "2nyiA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Sep 2007 11:50

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nyiA02

Flow stage update by auto on 09 Sep 2007 11:41

Retrieved PRC_PFAMCATH results for job ID SID7523920328317424 and results inserted.

Domain scan prc pfamcath by auto on 09 Sep 2007 11:40

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 11 results for 2nyiA02

Update comment by auto on 09 Sep 2007 08:35

PRC_PFAMCATH job SID7523920328317424 is not yet finished.

Flow stage update by auto on 09 Sep 2007 08:18

The entry "2nyiA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 09 Sep 2007 08:18

The entry "2nyiA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Sep 2007 06:52

Retrieved SSAP results for job ID SID6764206141473056 and results inserted.

Domain scan ssap cath by auto on 09 Sep 2007 06:42

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 4178 results for 2nyiA02

Update comment by auto on 05 Sep 2007 19:31

SSAP job SID6764206141473056 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:03

The entry "2nyiA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:03

The entry "2nyiA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 08:23

Retrieved PRC results for job ID SID4849338612284512 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 08:22

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2nyiA02

Prc cath submit by auto on 05 Sep 2007 03:41

The entry "2nyiA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:41

The entry "2nyiA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 17:08

Retrieved HMM(SAM) results for job ID SID8686717592636208 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 17:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2nyiA02

Update comment by auto on 04 Sep 2007 11:45

HMM(SAM) job SID8686717592636208 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:52

The entry "2nyiA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:52

The entry "2nyiA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 00:21

Retrieved "2nyiA02" CATHEDRAL results for job ID SID7370120793298400 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 00:19

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 167 results for 2nyiA02

Cathedral cath submit by auto on 03 Sep 2007 13:58

The entry "2nyiA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:58

The entry "2nyiA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:57

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nyiA02.scanlist" for "2nyiA02"

Write scan list by auto on 03 Sep 2007 11:57

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nyiA02.scanlist" for domain "2nyiA02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:15

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:14

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:31

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 19:59

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2nyiA02" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2nyiA02"

Flow stage update by auto on 23 Aug 2007 10:08

All required files are present for Domain "2nyiA02"

Flow stage update by auto on 22 Aug 2007 18:23

Beginning processing for Domain "2nyiA02"

Insertion by cuff on 22 Aug 2007 17:01

nice chopping