Domain assigned by cuff on 21 Feb 2008 14:04
same superfamily
CATH Domain: 2nxfA01
2nxfA01
PDB 2nxf, Chain A, Domain 1
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.60
| 4-Layer Sandwich | |
 3.60.21
| Purple Acid Phosphatase; chain A, domain 2 | |
 3.60.21.10
| Gene3D | |
 3.60.21.10.5
| ||
 3.60.21.10.5.1
| ||
 3.60.21.10.5.1.1
| ||
 3.60.21.10.5.1.1.1
| ||
 3.60.21.10.5.1.1.1.1
|
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2nxfA01 DPVFTFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDRALDTVAEL DACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWR ILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVL SVLRSHQSVLCFIAGHDHDGGRCTDSSGAQHITLEGVIETPPHSHAFATAYLYEDRVKGRGRV
Domain COMBS Sequence
>pdb|2nxfA01 SEDPVFTFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDRALDTVX AELDACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQRTGTDTGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEE SEKHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPIC LAWNHEAVLSVLRSHQSVLCFIAGHDHDGGRCTDSSGAQHITLEGVIETPPHSHAFATAYLYEDRXVXKGRGRV
Domain History Events (59)
Domain assignment manual match h by cuff on 21 Feb 2008 14:02
more than enough evidence for homology here. great scores and structural comparison
Domain assignment manual match t by tronnberg on 12 Sep 2007 11:02
SSAP: 79.20 OV: 81 SEQ: 13. Reasonable similar linkage and structure (differ with a alfa helix). None of the match in the ScanList with a SSAP score above 70 has the same function as the query.
Homcheck review by tronnberg on 12 Sep 2007 11:02
SSAP: 79.20 OV: 81 SEQ: 13. Reasonable similar linkage and structure (differ with a alfa helix). None of the match in the ScanList with a SSAP score above 70 has the same function as the query.
Flow stage update by tronnberg on 12 Sep 2007 11:02
SSAP: 79.20 OV: 81 SEQ: 13. Reasonable similar linkage and structure (differ with a alfa helix). None of the match in the ScanList with a SSAP score above 70 has the same function as the query.
Homcheck allotment by tronnberg on 12 Sep 2007 10:43
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 12 Sep 2007 10:43
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 11 Sep 2007 23:12
Domain "2nxfA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 11 Sep 2007 23:11
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nxfA01
Flow stage update by auto on 11 Sep 2007 23:02
Retrieved PRC_PFAMCATH results for job ID SID8846987306847647 and results inserted.
Domain scan prc pfamcath by auto on 11 Sep 2007 23:01
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 16 results for 2nxfA01
Update comment by auto on 11 Sep 2007 19:12
PRC_PFAMCATH job SID8846987306847647 is not yet finished.
Prc pfamcath submit by auto on 11 Sep 2007 19:10
The entry "2nxfA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 19:10
The entry "2nxfA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 11 Sep 2007 18:23
Retrieved SSAP results for job ID SID4636246610409930 and results inserted.
Domain scan ssap cath by auto on 11 Sep 2007 18:21
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 185 results for 2nxfA01
Update comment by auto on 09 Sep 2007 23:00
SSAP job SID4636246610409930 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:14
The entry "2nxfA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:14
The entry "2nxfA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:28
Giving up on SSAP job SID9877404360658048 because submission time of Wed Sep 5 16:02:41 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:28:17 2007).
Update comment by auto on 05 Sep 2007 19:31
SSAP job SID9877404360658048 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:02
The entry "2nxfA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:02
The entry "2nxfA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 08:20
Retrieved PRC results for job ID SID8618235758343424 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 08:19
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 2nxfA01
Flow stage update by auto on 05 Sep 2007 03:40
The entry "2nxfA01" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:40
The entry "2nxfA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 17:06
Retrieved HMM(SAM) results for job ID SID2310375429863936 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 17:05
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 7 results for 2nxfA01
Update comment by auto on 04 Sep 2007 11:45
HMM(SAM) job SID2310375429863936 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:51
The entry "2nxfA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:51
The entry "2nxfA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 00:14
Retrieved "2nxfA01" CATHEDRAL results for job ID SID0622735123938176 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 00:12
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 469 results for 2nxfA01
Cathedral cath submit by auto on 03 Sep 2007 13:58
The entry "2nxfA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:58
The entry "2nxfA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:56
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nxfA01.scanlist" for "2nxfA01"
Write scan list by auto on 03 Sep 2007 11:56
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nxfA01.scanlist" for domain "2nxfA01"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:58
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2nxfA01" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2nxfA01"
Flow stage update by auto on 23 Aug 2007 10:08
All required files are present for Domain "2nxfA01"
Flow stage update by auto on 22 Aug 2007 18:23
Beginning processing for Domain "2nxfA01"
Insertion by cuff on 22 Aug 2007 17:01
nice chopping
