Domain assigned by cuff on 18 Feb 2008 12:02
same superfamily
CATH Domain: 2nx2A00
2nx2A00
PDB 2nx2, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.40
| 3-Layer(aba) Sandwich | |
 3.40.50
| Rossmann fold | |
 3.40.50.450
| Gene3D | |
 3.40.50.450.2
| ||
 3.40.50.450.2.1
| ||
 3.40.50.450.2.1.1
| ||
 3.40.50.450.2.1.1.1
| ||
 3.40.50.450.2.1.1.1.1
|
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2nx2A00 SLKVLAITGYKPFELGIFKQDDKALYYIKKAIKNRLIAFLDEGLEWILISGQLGVELWAAEAAYDLQEEYPDLKVAVITP FYEQEKNWKEPNKEQYEAVLAQADYEASLTHRPYESPLQFKQKNQFFIDKSDGLLLLYDPEKEGSPKYMLGTAEKRREQD GYPIYFITMDDLRVTVEE
Domain History Events (70)
Domain assignment manual match h by rupa on 10 Sep 2007 12:58
Very high ssap score, same fold. Unknown function. Suggest score high enough for homology.
Homcheck review by rupa on 10 Sep 2007 12:58
Very high ssap score, same fold. Unknown function. Suggest score high enough for homology.
Flow stage update by rupa on 10 Sep 2007 12:58
Very high ssap score, same fold. Unknown function. Suggest score high enough for homology.
Homcheck allotment by rupa on 10 Sep 2007 12:21
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 10 Sep 2007 12:21
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Sep 2007 23:49
Domain "2nx2A00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Sep 2007 23:49
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nx2A00
Flow stage update by auto on 09 Sep 2007 23:39
Retrieved PRC_PFAMCATH results for job ID SID6796098802933344 and results inserted.
Domain scan prc pfamcath by auto on 09 Sep 2007 23:38
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 39 results for 2nx2A00
Update comment by auto on 09 Sep 2007 20:32
PRC_PFAMCATH job SID6796098802933344 is not yet finished.
Prc pfamcath submit by auto on 09 Sep 2007 20:30
The entry "2nx2A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Sep 2007 20:30
The entry "2nx2A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Sep 2007 19:28
Retrieved SSAP results for job ID SID0982193435184912 and results inserted.
Domain scan ssap cath by auto on 09 Sep 2007 19:24
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1910 results for 2nx2A00
Update comment by auto on 05 Sep 2007 19:31
SSAP job SID0982193435184912 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:02
The entry "2nx2A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:02
The entry "2nx2A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 08:16
Retrieved PRC results for job ID SID9494360374452864 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 08:15
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2nx2A00
Flow stage update by auto on 05 Sep 2007 03:40
The entry "2nx2A00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:40
The entry "2nx2A00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 17:02
Retrieved HMM(SAM) results for job ID SID5335485494702432 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 17:01
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2nx2A00
Update comment by auto on 04 Sep 2007 11:44
HMM(SAM) job SID5335485494702432 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:51
The entry "2nx2A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:51
The entry "2nx2A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 00:06
Retrieved "2nx2A00" CATHEDRAL results for job ID SID5422803136410336 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 00:05
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 460 results for 2nx2A00
Cathedral cath submit by auto on 03 Sep 2007 13:57
The entry "2nx2A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:57
The entry "2nx2A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:56
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nx2A00.scanlist" for "2nx2A00"
Write scan list by auto on 03 Sep 2007 11:56
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nx2A00.scanlist" for domain "2nx2A00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:16
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:36
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:15
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:42
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:22
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:28
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:32
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:49
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:14
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:11
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:20
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:20
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:13
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 27 Aug 2007 18:11
No satisfactory AssignClose result found.
Flow stage update by auto on 27 Aug 2007 18:04
No in_process hits for Domain "2nx2A00" ready to be processed
Flow stage update by auto on 27 Aug 2007 18:04
NW result present for Domain "2nx2A00"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2nx2A00"
Flow stage update by auto on 16 Aug 2007 17:14
Beginning processing for Domain "2nx2A00"
Insertion by cuff on 16 Aug 2007 14:05
nice chopping
