CATH Domain: 2nwiB00 XML data for domain: 2nwiB00

Molscript image for 2nwiB00
2nwiB00
PDB coordinates for domain 2nwiB00

PDB 2nwi, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1410 Chorismate lyase
3.40.1410.10 Chorismate lyase Gene3D
3.40.1410.10.8
3.40.1410.10.8.1
3.40.1410.10.8.1.1
3.40.1410.10.8.1.1.1
3.40.1410.10.8.1.1.1.1

[top]
Segment boundaries for domain 2nwiB00

Chopping figure for domain 2nwiB00
DomainStart PDB ResidueStop PDB Residue
2nwiB00 1 160

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ddvB01 83.65 GntR family transcriptional regulatorTranscriptional regulator, GntR familyEnterococcus faecalis 3.40.1410.10 137 10 82 2.55 3.11
2p19A01 83.52 Corynebacterium glutamicumBacterial regulatory proteins, gntR family 3.40.1410.10 130 15 78 2.46 3.12
2pkhB01 83.47 Pseudomonas syringae pv. tomatoHistidine utilization repressorGntR family transcriptional regulator, histidine utilization repressor 3.40.1410.10 129 13 78 1.98 2.51
2oggA01 81.64 GntR family transcriptional regulator, trehalose operon transcriptional repressorBacillus subtilisTrehalose operon transcriptional repressor 3.40.1410.10 133 6 80 2.68 3.34
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2nwiB00
LNAIHRILMTTDGSITAIIEAVTQKKVEVETLEQKIIRADRELAELLEIDEGDEVNYRVVYLRANGEIYAKAISFTPLKR
LENSFREDLGKIMRKHNIEARREIRWSRVEEADLALAKELGIADRRVISRNYNIIHRGKVLINITEFFPMERF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nwiB00
MSLNAIHRILMTTDGSITAIIEAVTQKKVEVETLEQKIIRADRELAELLEIDEGDEVNYRVVYLRANGEIYAKAISFTPL
KRLENSFREDLMRADIPIGKIMRKHNIEARREIRWSRVEEADLALAKELGIADRRVISRNYNIIHRGKVLINITEFFPME
RFRIEGHHHHHH
BLAST against CATH

[top]
Domain History Events (70)

Domain assigned by cuff on 18 Feb 2008 12:05

nice scores, same superfamily

Domain assignment manual match h by rupa on 10 Sep 2007 13:01

Excellent ssap score, same fold. Unknown function, but score should be high enough for homology.

Homcheck review by rupa on 10 Sep 2007 13:01

Excellent ssap score, same fold. Unknown function, but score should be high enough for homology.

Flow stage update by rupa on 10 Sep 2007 13:01

Excellent ssap score, same fold. Unknown function, but score should be high enough for homology.

Homcheck allotment by rupa on 10 Sep 2007 12:16

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 10 Sep 2007 12:16

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Sep 2007 11:50

Domain "2nwiB00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Sep 2007 11:49

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nwiB00

Flow stage update by auto on 09 Sep 2007 11:39

Retrieved PRC_PFAMCATH results for job ID SID0966884675462424 and results inserted.

Domain scan prc pfamcath by auto on 09 Sep 2007 11:38

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 14 results for 2nwiB00

Update comment by auto on 09 Sep 2007 08:31

PRC_PFAMCATH job SID0966884675462424 is not yet finished.

Flow stage update by auto on 09 Sep 2007 08:18

The entry "2nwiB00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 09 Sep 2007 08:18

The entry "2nwiB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Sep 2007 06:41

Retrieved SSAP results for job ID SID6267922765687488 and results inserted.

Domain scan ssap cath by auto on 09 Sep 2007 06:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1152 results for 2nwiB00

Update comment by auto on 05 Sep 2007 19:30

SSAP job SID6267922765687488 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 16:01

The entry "2nwiB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 16:01

The entry "2nwiB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 08:11

Retrieved PRC results for job ID SID7051304135114368 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 08:10

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2nwiB00

Prc cath submit by auto on 05 Sep 2007 03:39

The entry "2nwiB00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:39

The entry "2nwiB00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 16:57

Retrieved HMM(SAM) results for job ID SID5955682945591232 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 16:56

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 7 results for 2nwiB00

Update comment by auto on 04 Sep 2007 11:44

HMM(SAM) job SID5955682945591232 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:50

The entry "2nwiB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:50

The entry "2nwiB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 23:58

Retrieved "2nwiB00" CATHEDRAL results for job ID SID8669542424055040 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 23:57

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 188 results for 2nwiB00

Cathedral cath submit by auto on 03 Sep 2007 13:57

The entry "2nwiB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:57

The entry "2nwiB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:55

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nwiB00.scanlist" for "2nwiB00"

Write scan list by auto on 03 Sep 2007 11:55

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nwiB00.scanlist" for domain "2nwiB00"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:15

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:14

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:31

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:16

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:11

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:31

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:36

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:15

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:42

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:04

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:22

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:28

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:32

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:49

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:14

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:11

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:20

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:20

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:13

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Aug 2007 18:11

No satisfactory AssignClose result found.

Flow stage update by auto on 27 Aug 2007 18:04

No in_process hits for Domain "2nwiB00" ready to be processed

Flow stage update by auto on 27 Aug 2007 18:04

NW result present for Domain "2nwiB00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2nwiB00"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2nwiB00"

Insertion by auto on 16 Aug 2007 14:08

Final ChopClose added based on similarity with "2nwiE"