CATH Domain: 2nwhA00 XML data for domain: 2nwhA00

Molscript image for 2nwhA00
2nwhA00
PDB coordinates for domain 2nwhA00

PDB 2nwh, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1190 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase
3.40.1190.20 Gene3D
3.40.1190.20.8
3.40.1190.20.8.1
3.40.1190.20.8.1.1
3.40.1190.20.8.1.1.1
3.40.1190.20.8.1.1.1.1

[top]
Segment boundaries for domain 2nwhA00

Chopping figure for domain 2nwhA00
DomainStart PDB ResidueStop PDB Residue
2nwhA00 1 312

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.1190.20.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fv7A00 83.70 Pentose phosphate pathwayRibokinaseRibokinase [EC:2.7.1.15]Homo sapiens 3.40.1190.20 308 18 93 3.12 3.33
1v1aA00 82.56 Thermus thermophilus HB82-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose and glucuronate interconversionsPentose phosphate pathway2-keto-3-deoxy-gluconate kinase 3.40.1190.20 301 20 93 4.25 4.57
1tyyB00 81.37 Amino sugar and nucleotide sugar metabolismStarch and sucrose metabolismFructose and mannose metabolismMetabolic pathwaysFructokinase [EC:2.7.1.4] 3.40.1190.20 292 15 87 3.18 3.65
2qcvA01 81.05 5-dehydro-2-deoxygluconokinase [EC:2.7.1.92]Bacillus haloduransInositol phosphate metabolismMetabolic pathways5-dehydro-2-deoxygluconokinase 3.40.1190.20 262 19 78 3.44 4.38
2afbB00 81.01 Thermotoga maritima2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose phosphate pathwayPentose and glucuronate interconversions2-keto-3-deoxygluconate kinase 3.40.1190.20 319 13 87 4.03 4.61
2abqA00 80.65 Fructose 1-phosphate kinase1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismBacillus halodurans 3.40.1190.20 302 17 93 3.81 4.09
2ajrA01 77.94 Thermotoga maritima1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismSugar kinase, pfkB family 3.40.1190.20 259 12 79 3.51 4.41
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2nwhA00
MKKILVLGGAHIDRRGMIETETAPGASNPGSWMEEAGGGGFNAARNLSRLGFEVRIIAPRGGDVTGEVVAEAARQAGVED
TPFTFLDRRTPSYTAILERDGNLVIALADMDLYKLFTPRRLKVRAVREAIIASDFLLCDANLPEDTLTALGLIARACEKP
LAAIAISPAKAVKLKAALGDIDILFMNEAEARALTGVRDWPNILRKAGLSGGVVTRGASEVVAFNGTEKAILHPPLIREV
KDVTGAGDAMASGYLAAIAEGKTIREALRQGAAAAAITVQSSFATSQDLSKDSVEAMLGLVPQAEML
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nwhA00
GHMKKILVLGGAHIDRRGMIETETAPGASNPGSWMEEAGGGGFNAARNLSRLGFEVRIIAPRGGDVTGEVVAEAARQAGV
EDTPFTFLDRRTPSYTAILERDGNLVIALADMDLYKLFTPRRLKVRAVREAIIASDFLLCDANLPEDTLTALGLIARACE
KPLAAIAISPAKAVKLKAALGDIDILFMNEAEARALTGETAENVRDWPNILRKAGLSGGVVTRGASEVVAFNGTEKAILH
PPLIREVKDVTGAGDAMASGYLAAIAEGKTIREALRQGAAAAAITVQSSFATSQDLSKDSVEAMLGLVPQAEMLAGS
BLAST against CATH

[top]
Domain History Events (74)

Domain assigned by cuff on 21 Feb 2008 13:54

i agree. same superfamily

Domain assignment manual match h by tronnberg on 12 Sep 2007 10:34

SSAP: 78.57 OV: 83 SEQ: 18. Similar linkage and structure. They have the same function as carbohydrate kinases (transferase). All matches with a higher SSAP score then the chosen match, 1vk4A00, belongs to the same H-family as 1vk4A00.

Homcheck review by tronnberg on 12 Sep 2007 10:34

SSAP: 78.57 OV: 83 SEQ: 18. Similar linkage and structure. They have the same function as carbohydrate kinases (transferase). All matches with a higher SSAP score then the chosen match, 1vk4A00, belongs to the same H-family as 1vk4A00.

Flow stage update by tronnberg on 12 Sep 2007 10:34

SSAP: 78.57 OV: 83 SEQ: 18. Similar linkage and structure. They have the same function as carbohydrate kinases (transferase). All matches with a higher SSAP score then the chosen match, 1vk4A00, belongs to the same H-family as 1vk4A00.

Homcheck allotment by tronnberg on 12 Sep 2007 10:21

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 12 Sep 2007 10:21

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 12 Sep 2007 03:22

Domain "2nwhA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 12 Sep 2007 03:19

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nwhA00

Flow stage update by auto on 12 Sep 2007 03:14

Retrieved PRC_PFAMCATH results for job ID SID2599204824913840 and results inserted.

Domain scan prc pfamcath by auto on 12 Sep 2007 03:13

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 69 results for 2nwhA00

Update comment by auto on 11 Sep 2007 23:01

PRC_PFAMCATH job SID2599204824913840 is not yet finished.

Flow stage update by auto on 11 Sep 2007 22:59

The entry "2nwhA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 11 Sep 2007 22:59

The entry "2nwhA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Sep 2007 22:20

Retrieved SSAP results for job ID SID9728581225180852 and results inserted.

Domain scan ssap cath by auto on 11 Sep 2007 22:18

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 838 results for 2nwhA00

Update comment by auto on 09 Sep 2007 22:59

SSAP job SID9728581225180852 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:14

The entry "2nwhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:14

The entry "2nwhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 19:23

Giving up on SSAP job SID9834313917294368 because submission time of Wed Sep 5 16:01:42 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:23:57 2007).

Update comment by auto on 05 Sep 2007 19:30

SSAP job SID9834313917294368 is not yet finished.

Flow stage update by auto on 05 Sep 2007 16:01

The entry "2nwhA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 16:01

The entry "2nwhA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 08:13

Retrieved PRC results for job ID SID2573588538643200 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 08:12

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 19 results for 2nwhA00

Prc cath submit by auto on 05 Sep 2007 03:39

The entry "2nwhA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:39

The entry "2nwhA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 16:59

Retrieved HMM(SAM) results for job ID SID1137501652945607 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 16:58

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 17 results for 2nwhA00

Update comment by auto on 04 Sep 2007 11:44

HMM(SAM) job SID1137501652945607 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:51

The entry "2nwhA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:51

The entry "2nwhA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 00:02

Retrieved "2nwhA00" CATHEDRAL results for job ID SID2480017527589416 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 00:00

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 465 results for 2nwhA00

Cathedral cath submit by auto on 03 Sep 2007 13:57

The entry "2nwhA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:57

The entry "2nwhA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:55

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nwhA00.scanlist" for "2nwhA00"

Write scan list by auto on 03 Sep 2007 11:55

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nwhA00.scanlist" for domain "2nwhA00"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:31

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:36

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:32

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:21

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:21

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:27

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:15

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:14

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:31

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:16

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:11

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:31

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:36

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:15

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:42

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:04

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:22

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:28

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:32

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:49

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:14

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:11

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:20

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:20

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:13

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Aug 2007 18:11

No satisfactory AssignClose result found.

Flow stage update by auto on 27 Aug 2007 18:04

No in_process hits for Domain "2nwhA00" ready to be processed

Flow stage update by auto on 27 Aug 2007 18:04

NW result present for Domain "2nwhA00"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2nwhA00"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2nwhA00"

Insertion by cuff on 20 Aug 2007 14:17

nice chopping