CATH Domain: 2nvkX03 XML data for domain: 2nvkX03

Molscript image for 2nvkX03
2nvkX03
PDB coordinates for domain 2nvkX03

PDB 2nvk, Chain X, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.8
3.30.390.30.8.1
3.30.390.30.8.1.1
3.30.390.30.8.1.1.1
3.30.390.30.8.1.1.1.1

Segment boundaries for domain 2nvkX03

Chopping figure for domain 2nvkX03
DomainStart PDB ResidueStop PDB Residue
2nvkX01 8 162
2nvkX01 286 360
2nvkX02 163 285
2nvkX03 361 475

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.390.30.8.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ebdA03 89.09 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 23 95 1.89 1.98
1xdiA03 86.38 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 25 90 2.31 2.56
1mo9A03 82.60 2-oxopropyl-CoM reductase, carboxylatingXanthobacter autotrophicus Py2 3.30.390.30 153 20 72 2.15 2.96
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|2nvkX03
DVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEV
IQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLA    

Domain COMBS Sequence

>pdb|2nvkX03
DVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEV
IQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLA    

Domain History Events (6)

Domain assigned by auto on 01 Aug 2007 02:37

Assigning to "3.30.390.30" based on similarity with "2cfyA03"

Flow stage update by auto on 01 Aug 2007 02:33

No in_process hits for Domain "2nvkX03" ready to be processed

Flow stage update by auto on 01 Aug 2007 02:33

NW result present for Domain "2nvkX03"

Flow stage update by auto on 16 Jul 2007 22:39

All required files are present for Domain "2nvkX03"

Flow stage update by auto on 15 Jul 2007 03:11

Beginning processing for Domain "2nvkX03"

Insertion by auto on 15 Jul 2007 02:31

Final ChopClose added based on similarity with "2j3nB"