CATH Domain: 2nvaC02 XML data for domain: 2nvaC02

Molscript image for 2nvaC02
2nvaC02
PDB coordinates for domain 2nvaC02

PDB 2nva, Chain C, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.10 Alanine racemase Gene3D
3.20.20.10.5
3.20.20.10.5.1
3.20.20.10.5.1.1
3.20.20.10.5.1.1.1
3.20.20.10.5.1.1.1.1

[top]
Segment boundaries for domain 2nvaC02

Chopping figure for domain 2nvaC02
DomainStart PDB ResidueStop PDB Residue
2nvaC01 9 24
2nvaC01 258 369
2nvaC02 25 257

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.20.20.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2p3eA02 86.66 Diaminopimelate decarboxylase [EC:4.1.1.20]Diaminopimelate decarboxylaseMetabolic pathwaysLysine biosynthesisAquifex aeolicus 3.20.20.10 223 26 93 2.56 2.74
2o0tA02 85.18 Lysine biosynthesisMetabolic pathwaysDiaminopimelate decarboxylase [EC:4.1.1.20]Diaminopimelate decarboxylaseMycobacterium tuberculosis 3.20.20.10 260 17 87 2.90 3.31
1knwA02 84.01 Lysine biosynthesisMetabolic pathwaysDiaminopimelate decarboxylase [EC:4.1.1.20]Diaminopimelate decarboxylaseProtein binding 3.20.20.10 244 18 90 2.79 3.08
1xfcB02 81.65 Alanine racemaseMycobacterium tuberculosis 3.20.20.10 216 11 87 2.59 2.95
1w8gA00 80.64 UPF0001 protein yggSEscherichia coli K-12 3.20.20.10 226 11 87 2.86 3.26
1ct5A00 79.71 UPF0001 protein YBL036CIdentical protein bindingPyridoxal phosphate bindingSaccharomyces cerevisiae 3.20.20.10 225 9 84 3.34 3.96
3ctlA00 75.21 [EC:5.1.3.-]D-allulose-6-phosphate 3-epimeraseAllulose 6-phosphate 3-epimerase activityProtein bindingEscherichia coli K-12 3.20.20.70 219 8 75 3.70 4.90
2fliC00 74.86 Pentose phosphate pathwayPentose and glucuronate interconversionsMetabolic pathwaysRibulose-phosphate 3-epimerase [EC:5.1.3.1]Streptococcus pyogenes serotype M1 3.20.20.70 219 8 75 3.77 4.99
1tqjC00 74.82 Ribulose-phosphate 3-epimerasePentose phosphate pathwayPentose and glucuronate interconversionsCarbon fixation in photosynthetic organismsRibulose-phosphate 3-epimerase [EC:5.1.3.1] 3.20.20.70 218 7 75 3.68 4.84
1q6oB00 74.10 Ascorbate and aldarate metabolism3-keto-L-gulonate-6-phosphate decarboxylase ulaDMagnesium ion binding3-dehydro-L-gulonate-6-phosphate decarboxylase [EC:4.1.1.85]3-dehydro-L-gulonate-6-phosphate decarboxylase activity 3.20.20.70 215 6 75 3.60 4.79
1wbhB00 73.18 Arginine and proline metabolismGlyoxylate and dicarboxylate metabolismMetabolic pathwaysPentose and glucuronate interconversionsPentose phosphate pathway 3.20.20.70 214 6 76 3.65 4.75
2chrA02 72.82 Ralstonia eutropha JMP134Chloromuconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylation 3.20.20.120 202 6 76 3.75 4.88
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2nvaC02
KIVEDLIDQWTILFPRVTPHYAVKCNNDEVLLKTMCDKNVNFDCASSSEIKKVIQIGVSPSRIIFAHTMKTIDDLIFAKD
QGVDIATFDSSFELDKIHTYHPNCKMILRIRCDDPNATVQLGNKFGANEDEIRHLLEYAKQLDIEVIGISFHVGSGSRNP
EAYYRAIKSSKEAFNEAISVGHKPYILDIGGGLHADIELSTMSDYINDAIKDFFPEDTVTIVAEPGRFF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nvaC02
KIVEDLIDQWTILFPRVTPHYAVKCNNDEVLLKTMCDKNVNFDCASSSEIKKVIQIGVSPSRIIFAHTMKTIDDLIFAKD
QGVDIATFDSSFELDKIHTYHPNCKMILRIRCDDPNATVQLGNKFGANEDEIRHLLEYAKQLDIEVIGISFHVGSGSRNP
EAYYRAIKSSKEAFNEAISVGHKPYILDIGGGLHADIDEGELSTYMSDYINDAIKDFFPEDTVTIVAEPGRFF
BLAST against CATH

[top]
Domain History Events (18)

Domain assigned by auto on 15 Aug 2007 07:01

Assigning to "3.20.20.10" based on similarity with "2nvaD02"

Flow stage update by auto on 15 Aug 2007 06:55

No in_process hits for Domain "2nvaC02" ready to be processed

Update comment by auto on 15 Aug 2007 06:33

Domain "2nvaC02" hits Domain "2nvaF02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:08

Domain "2nvaC02" hits Domain "2nvaB02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:39

Domain "2nvaC02" hits Domain "2nvaA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:07

Domain "2nvaC02" hits Domain "2nvaE02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:36

Domain "2nvaC02" hits Domain "2nvaH02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:01

Domain "2nvaC02" hits Domain "2nvaG02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:22

Domain "2nvaC02" hits Domain "2nvaD02" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:40

Domain "2nvaC02" hits Domain "2nv9H02" (99.5708154506438% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:40

Domain "2nvaC02" hits Domain "2nv9A02" (99.5708154506438% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:08

Domain "2nvaC02" hits Domain "2nv9D02" (99.5708154506438% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:51

Domain "2nvaC02" hits Domain "2nv9G02" (99.5708154506438% over 100%) which is currently in process

Flow stage update by auto on 01 Aug 2007 02:33

Domain "2nvaC02" hits Domain "2nv9F02" (99.5708154506438% over 100%) which is currently in process

Flow stage update by auto on 01 Aug 2007 02:33

NW result present for Domain "2nvaC02"

Flow stage update by auto on 16 Jul 2007 22:39

All required files are present for Domain "2nvaC02"

Flow stage update by auto on 14 Jul 2007 23:03

Beginning processing for Domain "2nvaC02"

Insertion by auto on 14 Jul 2007 22:23

Final ChopClose added based on similarity with "2nvaE"