CATH Domain: 2nu8B02 XML data for domain: 2nu8B02

Molscript image for 2nu8B02
2nu8B02
PDB coordinates for domain 2nu8B02

PDB 2nu8, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.15
3.30.1490.20.15.1
3.30.1490.20.15.1.1
3.30.1490.20.15.1.1.1
3.30.1490.20.15.1.1.1.1

[top]
Segment boundaries for domain 2nu8B02

Chopping figure for domain 2nu8B02
DomainStart PDB ResidueStop PDB Residue
2nu8B01 1 20
2nu8B01 105 239
2nu8B02 21 104
2nu8B03 240 388

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ta8A02 81.05 DNA ligase (NAD+) [EC:6.5.1.2]DNA replicationNucleotide excision repairBase excision repairDNA ligase 3.30.1490.70 99 7 73 3.29 4.46
1a0iA01 79.27 Enterobacteria phage T7DNA ligase 3.30.1490.70 83 10 71 3.50 4.90
1v9pA02 79.10 DNA ligaseThermus filiformis 3.30.1490.70 98 10 73 3.20 4.36
2r6fA03 76.66 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 7 70 3.40 4.84
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2nu8B02
VGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEA
ATDI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nu8B02
VGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEA
ATDI
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 21 Aug 2007 22:28

Assigning to "3.30.1490.20" based on similarity with "1cqiB02"

Flow stage update by auto on 21 Aug 2007 22:27

No in_process hits for Domain "2nu8B02" ready to be processed

Update comment by auto on 21 Aug 2007 22:20

Domain "2nu8B02" hits Domain "2nuaB02" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Aug 2007 22:13

Domain "2nu8B02" hits Domain "2nuaB02" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Aug 2007 22:13

NW result present for Domain "2nu8B02"

Flow stage update by auto on 16 Aug 2007 17:16

All required files are present for Domain "2nu8B02"

Flow stage update by auto on 16 Aug 2007 00:03

Beginning processing for Domain "2nu8B02"

Insertion by auto on 15 Aug 2007 19:43

Final ChopClose added based on similarity with "1jkjB"