CATH Domain: 2nteA02 XML data for domain: 2nteA02

Molscript image for 2nteA02
2nteA02
PDB coordinates for domain 2nteA02

PDB 2nte, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.10190 Gene3D
3.40.50.10190.2
3.40.50.10190.2.1
3.40.50.10190.2.1.1
3.40.50.10190.2.1.1.1
3.40.50.10190.2.1.1.1.1

Segment boundaries for domain 2nteA02

Chopping figure for domain 2nteA02
DomainStart PDB ResidueStop PDB Residue
2nteA01 568 667
2nteA02 668 771

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2nteA02
LPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHP
ERVRQGKVWKAPSSWFIDCVMSFE    

Domain COMBS Sequence

>pdb|2nteA02
LPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHP
ERVRQGKVWKAPSSWFIDCVMSFE    

Domain History Events (9)

Domain assigned by auto on 17 Apr 2009 12:13

Assigning to "3.40.50.10190" based on similarity with "2r1zA02"

Flow stage update by auto on 17 Apr 2009 12:09

No in_process hits for Domain "2nteA02" ready to be processed

Update comment by auto on 17 Apr 2009 11:40

Domain "2nteA02" hits Domain "2r1zB02" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 14:33

Domain "2nteA02" hits Domain "2r1zA02" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:19

Domain "2nteA02" hits Domain "2r1zA02" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2nteA02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2nteA02"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2nteA02"

Insertion by auto on 05 Dec 2008 17:55

Final ChopClose added based on similarity with "2nteB"