CATH Domain: 2nteA01 XML data for domain: 2nteA01

Molscript image for 2nteA01
2nteA01
PDB coordinates for domain 2nteA01

PDB 2nte, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.10190 Gene3D
3.40.50.10190.4
3.40.50.10190.4.1
3.40.50.10190.4.1.1
3.40.50.10190.4.1.1.1
3.40.50.10190.4.1.1.1.1

[top]
Segment boundaries for domain 2nteA01

Chopping figure for domain 2nteA01
DomainStart PDB ResidueStop PDB Residue
2nteA01 568 667
2nteA02 668 771

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.10190.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gzhB01 85.18 CytoplasmHomo sapiensTumor suppressor p53-binding protein 1Protein binding 3.40.50.10190 103 10 79 2.43 3.05
1cdzA00 84.77 DNA repair protein XRCC1Homo sapiensProtein binding 3.40.50.10190 96 8 88 2.84 3.23
1imoA00 77.51 DNA ligase 3Reciprocal meiotic recombinationDNA bindingHomo sapiensProtein binding 3.40.50.10190 88 12 66 3.19 4.83
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2nteA01
GPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQ
EEKYEIPEGPRRSRLNREQL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nteA01
GPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQ
EEKYEIPEGPRRSRLNREQL
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 19 Mar 2009 11:54

Assigning to "3.40.50.10190" based on similarity with "2r1zB01"

Flow stage update by auto on 19 Mar 2009 11:50

No in_process hits for Domain "2nteA01" ready to be processed

Update comment by auto on 19 Mar 2009 11:27

Domain "2nteA01" hits Domain "2r1zB01" (100% over 99%) which is currently in process

Update comment by auto on 10 Dec 2008 14:33

Domain "2nteA01" hits Domain "2r1zA01" (100% over 99%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:19

Domain "2nteA01" hits Domain "2r1zA01" (100% over 99%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2nteA01"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2nteA01"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2nteA01"

Insertion by auto on 05 Dec 2008 17:55

Final ChopClose added based on similarity with "2nteB"