Classification merge by cuff on 27 Jun 2008 15:54
COMMENT: merge 2.60.360.10 -> 2.60.40.1180 FINAL: merge 2.60.360.10 -> 2.60.40.1180*
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2nt0A01 | 5 | 30 |
| 2nt0A01 | 78 | 431 |
| 2nt0A02 | 35 | 77 |
| 2nt0A02 | 432 | 497 |
There are 10 matching structural neighberhood comparisons for CATH ID 2.60.40.1180.14.1.1.1.1 (SIMAX score < 5)
>pdb|2nt0A02 GTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDV PLTIKDPAVGFLETISPGYSIHTYLWHRQ
COMMENT: merge 2.60.360.10 -> 2.60.40.1180 FINAL: merge 2.60.360.10 -> 2.60.40.1180*
Assigning to "2.60.360.10" based on similarity with "2nt0C02"
No in_process hits for Domain "2nt0A02" ready to be processed
Domain "2nt0A02" hits Domain "2nt1A02" (100% over 100%) which is currently in process
Domain "2nt0A02" hits Domain "2nt1D02" (100% over 100%) which is currently in process
Domain "2nt0A02" hits Domain "2nt1C02" (100% over 100%) which is currently in process
Domain "2nt0A02" hits Domain "2nt1B02" (100% over 100%) which is currently in process
Domain "2nt0A02" hits Domain "2nt1B02" (100% over 100%) which is currently in process
NW result present for Domain "2nt0A02"
All required files are present for Domain "2nt0A02"
Beginning processing for Domain "2nt0A02"
Final ChopClose added based on similarity with "1ogsA"