Domain assigned by cuff on 16 May 2008 11:38
same superfamily
CATH Domain: 2nr7A00
2nr7A00
PDB 2nr7, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2nr7A00 NAANVKLLLPYILKWEGGFVHDPADAGGATNKGVTIATWKRVGYDKDGDGDIDVEDLKLLTDDDVLNRVLKPFYWDRWKA DLIESQKVANILVDWVWGSGKYGIVIPQRILGVQADGIVGNKTLQAVNSADPDELFESIFDARREFLEDITARSIKKYED SIGRKATERELLRHTNKRFLRGWLNRLEDIRKL
Domain History Events (72)
Domain assignment manual match h by cuff on 16 May 2008 11:36
nice scores, same function, sme family in scop
Domain assignment manual match a by tronnberg on 10 Sep 2007 12:07
SSAP: 70.01 OV: 63 SEQ: 6. I think that the query might fit into this architecture.
Homcheck review by tronnberg on 10 Sep 2007 12:07
SSAP: 70.01 OV: 63 SEQ: 6. I think that the query might fit into this architecture.
Flow stage update by tronnberg on 10 Sep 2007 12:07
SSAP: 70.01 OV: 63 SEQ: 6. I think that the query might fit into this architecture.
Homcheck allotment by tronnberg on 10 Sep 2007 12:04
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Sep 2007 12:04
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Sep 2007 15:42
Domain "2nr7A00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Sep 2007 15:39
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nr7A00
Flow stage update by auto on 09 Sep 2007 15:36
Retrieved PRC_PFAMCATH results for job ID SID5623214988156704 and results inserted.
Domain scan prc pfamcath by auto on 09 Sep 2007 15:35
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 7 results for 2nr7A00
Update comment by auto on 09 Sep 2007 11:35
PRC_PFAMCATH job SID5623214988156704 is not yet finished.
Flow stage update by auto on 09 Sep 2007 11:33
The entry "2nr7A00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 09 Sep 2007 11:33
The entry "2nr7A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Sep 2007 10:39
Retrieved SSAP results for job ID SID7672697056305312 and results inserted.
Domain scan ssap cath by auto on 09 Sep 2007 10:37
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 347 results for 2nr7A00
Update comment by auto on 05 Sep 2007 19:29
SSAP job SID7672697056305312 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:59
The entry "2nr7A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:59
The entry "2nr7A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 07:58
Retrieved PRC results for job ID SID5132726864209088 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 07:57
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2nr7A00
Prc cath submit by auto on 05 Sep 2007 03:37
The entry "2nr7A00" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:37
The entry "2nr7A00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 16:45
Retrieved HMM(SAM) results for job ID SID8861566164003136 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 16:44
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2nr7A00
Update comment by auto on 04 Sep 2007 11:43
HMM(SAM) job SID8861566164003136 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:49
The entry "2nr7A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:49
The entry "2nr7A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 23:41
Retrieved "2nr7A00" CATHEDRAL results for job ID SID9645579751040944 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 23:40
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 91 results for 2nr7A00
Cathedral cath submit by auto on 03 Sep 2007 13:55
The entry "2nr7A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:55
The entry "2nr7A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:53
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nr7A00.scanlist" for "2nr7A00"
Write scan list by auto on 03 Sep 2007 11:53
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nr7A00.scanlist" for domain "2nr7A00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:26
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:13
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:16
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:36
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:15
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:42
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:22
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:28
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:32
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:49
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:13
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:11
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:20
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:20
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:13
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 14:13
Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 27 Aug 2007 14:11
No satisfactory AssignClose result found.
Flow stage update by auto on 27 Aug 2007 14:04
No in_process hits for Domain "2nr7A00" ready to be processed
Flow stage update by auto on 27 Aug 2007 14:04
NW result present for Domain "2nr7A00"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2nr7A00"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "2nr7A00"
Insertion by cuff on 18 Aug 2007 13:26
nice chopping
