CATH Domain: 2np2A00 XML data for domain: 2np2A00

Molscript image for 2np2A00
2np2A00
PDB coordinates for domain 2np2A00

PDB 2np2, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.520 HU Protein; Chain A
4.10.520.10 HU Protein, subunit A Gene3D
4.10.520.10.4
4.10.520.10.4.1
4.10.520.10.4.1.1
4.10.520.10.4.1.1.1
4.10.520.10.4.1.1.1.1

[top]
Segment boundaries for domain 2np2A00

Chopping figure for domain 2np2A00
DomainStart PDB ResidueStop PDB Residue
2np2A00 6 107

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.520.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1exeA00 79.57 Transcription factor 1Bacillus phage SPO1 4.10.520.10 99 19 91 3.95 4.33
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2np2A00
RPKVTKSDIVDQIALNIKNNNLKLEKKYIRLVIDAFFEELKSNLCSNNVIEFRSFGTFEVRKRKGRLNARNPQTGEYVKV
LDHHVAYFRPGKDLKERVWGIK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2np2A00
MSFSRRPKVTKSDIVDQIALNIKNNNLKLEKKYIRLVIDAFFEELKSNLCSNNVIEFRSFGTFEVRKRKGRLNARNPQTG
EYVKVLDHHVAYFRPGKDLKERVWGIKG
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 31 Jul 2007 18:40

Assigning to "4.10.520.10" based on similarity with "1ihfB00"

Flow stage update by auto on 31 Jul 2007 18:37

No in_process hits for Domain "2np2A00" ready to be processed

Flow stage update by auto on 31 Jul 2007 18:37

NW result present for Domain "2np2A00"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2np2A00"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "2np2A00"

Insertion by auto on 14 Jul 2007 04:55

Final ChopClose added based on similarity with "2np2B"