CATH Domain: 2nlyA00 XML data for domain: 2nlyA00

Molscript image for 2nlyA00
2nlyA00
PDB coordinates for domain 2nlyA00

PDB 2nly, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.370 Glycoside hydrolase/deacetylase Gene3D
3.20.20.370.5
3.20.20.370.5.1
3.20.20.370.5.1.1
3.20.20.370.5.1.1.1
3.20.20.370.5.1.1.1.1

[top]
Segment boundaries for domain 2nlyA00

Chopping figure for domain 2nlyA00
DomainStart PDB ResidueStop PDB Residue
2nlyA00 31 254

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2nlyA00
MKRAAIIIDDFGGDVKGVDDFLTGEIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEPKPSGITSNLSVGEVKSRVR
KAFDDIPYAVGLNNHMGSKIVENEKIMRAILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSRKEV
IKNMRKLAKKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLLP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nlyA00
GEMKRAAIIIDDFGGDVKGVDDFLTGEIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEPKKGKISWLGPSGITSNL
SVGEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMRAILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFL
DNTHSSRKEVIKNMRKLAKKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLLP
BLAST against CATH

[top]
Domain History Events (106)

Domain assigned by cuff on 04 Mar 2008 21:25

i agree, same superfamily

Homcheck comment by rupa on 11 Sep 2007 14:03

After further review, this still appears to be the most appropriate choice.

Domain assignment manual match h by rupa on 21 Aug 2007 11:19

Good cathedral and ssap score, same folding and same function (pfam).

Homcheck review by rupa on 21 Aug 2007 11:19

Good cathedral and ssap score, same folding and same function (pfam).

Flow stage update by rupa on 21 Aug 2007 11:19

Good cathedral and ssap score, same folding and same function (pfam).

Homcheck allotment by rupa on 21 Aug 2007 11:18

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 21 Aug 2007 11:18

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 21 Aug 2007 00:10

Domain "2nlyA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 21 Aug 2007 00:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2nlyA00

Flow stage update by auto on 20 Aug 2007 23:56

Retrieved PRC_PFAMCATH results for job ID SID0779033900937117 and results inserted.

Domain scan prc pfamcath by auto on 20 Aug 2007 23:55

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 2nlyA00

Update comment by auto on 20 Aug 2007 19:01

PRC_PFAMCATH job SID0779033900937117 is not yet finished.

Flow stage update by auto on 20 Aug 2007 18:58

The entry "2nlyA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 20 Aug 2007 18:58

The entry "2nlyA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Aug 2007 17:46

Retrieved SSAP results for job ID SID3944271480387896 and chopping inserted.

Domain scan ssap cath by auto on 20 Aug 2007 17:44

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1060 results for 2nlyA00

Update comment by auto on 19 Aug 2007 07:42

SSAP job SID3944271480387896 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 06:38

The entry "2nlyA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 06:38

The entry "2nlyA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 02:32

Giving up on SSAP job SID7587034068801328 because submission time of Thu Aug 16 22:38:29 2007 is more than 172800 seconds older than current time (Sun Aug 19 02:32:41 2007).

Update comment by auto on 16 Aug 2007 23:43

SSAP job SID7587034068801328 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 22:38

The entry "2nlyA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 22:38

The entry "2nlyA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 17:32

Giving up on SSAP job SID7976623948380096 because submission time of Tue Aug 14 09:08:13 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:32:24 2007).

Update comment by auto on 14 Aug 2007 10:37

SSAP job SID7976623948380096 is not yet finished.

Flow stage update by auto on 14 Aug 2007 09:08

The entry "2nlyA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 09:08

The entry "2nlyA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 06:40

Retrieved PRC results for job ID SID2131679273416272 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 06:40

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2nlyA00

Prc cath submit by auto on 13 Aug 2007 10:40

The entry "2nlyA00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 10:40

The entry "2nlyA00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 08:16

Retrieved HMM(SAM) results for job ID SID9401132472603920 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 08:15

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2nlyA00

Update comment by auto on 12 Aug 2007 13:10

HMM(SAM) job SID9401132472603920 is not yet finished.

Flow stage update by auto on 12 Aug 2007 11:54

The entry "2nlyA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 12 Aug 2007 11:54

The entry "2nlyA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 04:20

Retrieved "2nlyA00" CATHEDRAL results for job ID SID7169344744469040 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 04:19

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2nlyA00

Update comment by auto on 11 Aug 2007 05:57

"2nlyA00" CATHEDRAL job SID7169344744469040 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:25

The entry "2nlyA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:25

The entry "2nlyA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:30

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2nlyA00.scanlist" for "2nlyA00"

Write scan list by auto on 11 Aug 2007 02:30

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2nlyA00.scanlist" for domain "2nlyA00"

Update comment by auto on 10 Aug 2007 14:32

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:32

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:45

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:47

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:33

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:14

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:58

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:58

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:44

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:51

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:35

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:43

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:42

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:05

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:51

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:57

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:46

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:32

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:14

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:44

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:56

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:49

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:37

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:50

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:44

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:22

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:17

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:15

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:04

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:22

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:13

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:51

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:07

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:10

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:10

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 07:00

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:09

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:57

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:53

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:49

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:01

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:03

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:02

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:47

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:31

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:25

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:05

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:05

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 03:03

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:44

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:34

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:07

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:58

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:59

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 03:03

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:43

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 19:02

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Jul 2007 18:39

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Jul 2007 18:37

No in_process hits for Domain "2nlyA00" ready to be processed

Flow stage update by auto on 31 Jul 2007 18:37

NW result present for Domain "2nlyA00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2nlyA00"

Flow stage update by auto on 10 Jul 2007 12:04

Beginning processing for Domain "2nlyA00"

Insertion by cuff on 10 Jul 2007 10:51

nice chopping