CATH Domain: 2nllA00 XML data for domain: 2nllA00

Molscript image for 2nllA00
2nllA00
PDB coordinates for domain 2nllA00

PDB 2nll, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.50 Erythroid Transcription Factor GATA-1; Chain A
3.30.50.10 Erythroid Transcription Factor GATA-1, subunit A Gene3D
3.30.50.10.3
3.30.50.10.3.1
3.30.50.10.3.1.1
3.30.50.10.3.1.1.1
3.30.50.10.3.1.1.1.1

[top]
Segment boundaries for domain 2nllA00

Chopping figure for domain 2nllA00
DomainStart PDB ResidueStop PDB Residue
2nllA00 135 200

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.50.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hcqB00 92.68 Estrogen receptorTranscription, DNA-dependentPositive regulation of retinoic acid receptor signaling pathwayNuclear receptor, subfamily 3, group A, member 1Homo sapiens 3.30.50.10 71 53 92 1.02 1.10
1kb2B00 89.06 Vitamin D3 receptorVitamin D receptor signaling pathwayNuclear receptor, subfamily 1, group I, member 1Retinoid X receptor bindingPositive regulation of vitamin D 24-hydroxylase activity 3.30.50.10 85 46 77 0.88 1.13
2a66A00 87.62 Promoter bindingPositive regulation of gene-specific transcriptionNucleusProtein bindingNuclear receptor, subfamily 5, group A, member 2 3.30.50.10 95 62 69 0.84 1.21
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2nllA00
CAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2nllA00
CAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGM
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"