CATH Domain: 2napA01 XML data for domain: 2napA01

Molscript image for 2napA01
2napA01
PDB coordinates for domain 2napA01

PDB 2nap, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.90 ADC-like domains Gene3D
2.20.25.90.1
2.20.25.90.1.1
2.20.25.90.1.1.1
2.20.25.90.1.1.1.1
2.20.25.90.1.1.1.1.1

[top]
Segment boundaries for domain 2napA01

Chopping figure for domain 2napA01
DomainStart PDB ResidueStop PDB Residue
2napA01 4 61
2napA02 62 139
2napA02 346 562
2napA03 140 345
2napA03 563 594
2napA04 610 723

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.20.25.90.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2iv2X01 91.69 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 2.20.25.90 55 36 94 1.33 1.40
2vpzA01 87.24 Thermus thermophilus HB27Thiosulfate reductase [EC:1.-.-.-]Thiosulfate reductase 2.20.25.90 67 20 86 1.76 2.03
1q16A03 82.80 Nitrogen metabolismTwo-component systemProtein bindingRespiratory nitrate reductase 1 alpha chainEscherichia coli K-12 2.20.25.90 47 14 67 1.79 2.66
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2napA01
RPEKWVKGVCRYCGTGCGVLVGVKDGKAVAIQGNPNNHNAGLLCLKGSLLIPVLNSKE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2napA01
ADNRPEKWVKGVCRYCGTGCGVLVGVKDGKAVAIQGNPNNHNAGLLCLKGSLLIPVLNSKE
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 28 Apr 2008 17:16

Assigning to "2.20.25.90" based on similarity with "1aa6A01"

Flow stage update by auto on 28 Apr 2008 17:07

No in_process hits for Domain "2napA01" ready to be processed

Update comment by auto on 13 Nov 2007 00:14

Domain "2napA01" hits Domain "1aa6A01" (36.3636363636364% over 90.1639344262295%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2napA01" hits Domain "1aa6001" (36.3636363636364% over 90.1639344262295%) which is currently in process

Update comment by auto on 03 Sep 2007 11:17

Domain "2napA01" hits Domain "1aa6001" (36.3636363636364% over 90.1639344262295%) which is currently in process

Update comment by auto on 14 Aug 2007 22:43

Domain "2napA01" hits Domain "1aa6001" (36.3636363636364% over 90.1639344262295%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:07

Domain "2napA01" hits Domain "1aa6001" (36.3636363636364% over 90.1639344262295%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:05

NW result present for Domain "2napA01"

Flow stage update by auto on 14 Mar 2007 15:01

All required files are present for Domain "2napA01"

Flow stage update by auto on 14 Mar 2007 14:59

Beginning processing for Domain "2napA01"

Insertion by cuff on 18 Dec 2006 12:59

nice selection of choppings