Set cath from cathlist by auto on 05 Mar 2006 19:16
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2nacA01 | 1 | 145 |
| 2nacA01 | 336 | 374 |
| 2nacA02 | 146 | 335 |
There are 22 matching structural neighberhood comparisons for CATH ID 3.40.50.720.33.1.1.1.1 (SIMAX score < 5)
>pdb|2nacA02 NSISVAEHVVMMILSLVRNYLPSHEWARKGGWNIADCVSHAYDLEAMHVGTVAAGRIGLAVLRRLAPFDVHLHYTDRHRL PESVEKELNLTWHATREDMYPVCDVVTLNCPLHPETEHMINDETLKLFKRGAYIVNTARGKLCDRDAVARALESGRLAGY AGDVWFPQPAPKDHPWRTMPYNGMTPHISG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"