Set cath from cathlist by auto on 05 Mar 2006 19:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 2kfnA01
2kfnA01
PDB 2kfn, Chain A, Domain 1
Segment boundaries for domain 2kfnA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2kfnA01 | 326 | 542 |
| 2kfnA02 | 543 | 658 |
| 2kfnA03 | 659 | 708 |
| 2kfnA03 | 853 | 927 |
| 2kfnA04 | 709 | 852 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.420.10.19.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1noyB02 | 76.96 | 3.30.420.10 | 226 | 7 | 70 | 3.53 | 4.99 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2kfnA01 SYDNYVTILDEETLKAWIAKLEKAPVFAFDTETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERALELL KPLLEDEKALKVGQNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLT FNQIALEEAGRYAAEDADVTLQLHLKMWPDLQKHKGPLNVFENIEMPLVPVLSRIER
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 19:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 17:55
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
