CATH Domain: 2k0zA00 XML data for domain: 2k0zA00

Molscript image for 2k0zA00
2k0zA00
PDB coordinates for domain 2k0zA00

PDB 2k0z, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.250 Oxidized Rhodanese; domain 1
3.40.250.10 Oxidized Rhodanese, domain 1 Gene3D
3.40.250.10.20
3.40.250.10.20.1
3.40.250.10.20.1.1
3.40.250.10.20.1.1.1
3.40.250.10.20.1.1.1.1

[top]
Segment boundaries for domain 2k0zA00

Chopping figure for domain 2k0zA00
DomainStart PDB ResidueStop PDB Residue
2k0zA00 1 110

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2k0zA00
MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSQHKDKKVLLHCRAGRRALDAAKSMHELG
YTPYYLEGNVYDFEKYGFRMVYDDTCDKKN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2k0zA00
MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLSQHKDKKVLLHCRAGRRALDAAKSMHELG
YTPYYLEGNVYDFEKYGFRMVYDDTCDKKN
BLAST against CATH

[top]
Domain History Events (91)

Domain assigned by cuff on 03 Mar 2009 12:39

homology match

Domain assignment manual match h by cuff on 03 Mar 2009 12:35

same superfamily

Homcheck allotment by cuff on 12 Feb 2009 11:52

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 12 Feb 2009 11:52

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 18:07

Domain "2k0zA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 18:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2k0zA00

Flow stage update by auto on 06 Nov 2008 18:03

Retrieved PRC_PFAMCATH results for job ID SID3521320509577632 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 18:03

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 23 results for 2k0zA00

Update comment by auto on 06 Nov 2008 15:02

PRC_PFAMCATH job SID3521320509577632 is not yet finished.

Prc pfamcath submit by auto on 06 Nov 2008 15:00

The entry "2k0zA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 15:00

The entry "2k0zA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 14:57

Retrieved SSAP results for job ID SID0574925294227552 and results inserted.

Domain scan ssap cath by auto on 06 Nov 2008 14:52

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2298 results for 2k0zA00

Update comment by auto on 03 Nov 2008 17:53

SSAP job SID0574925294227552 is not yet finished.

Flow stage update by auto on 03 Nov 2008 17:43

The entry "2k0zA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 03 Nov 2008 17:43

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:38

Giving up on SSAP job SID1579828752678888 because submission time of Tue Oct 28 12:21:17 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:38:39 2008).

Update comment by auto on 28 Oct 2008 12:46

SSAP job SID1579828752678888 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:21

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:21

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 09:07

Giving up on SSAP job SID2861036737366336 because submission time of Wed Oct 22 09:34:28 2008 is more than 518400 seconds older than current time (Tue Oct 28 09:07:21 2008).

Update comment by auto on 22 Oct 2008 09:47

SSAP job SID2861036737366336 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:34

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:34

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:30

Giving up on SSAP job SID9616733048568328 because submission time of Thu Oct 16 06:10:34 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:30:09 2008).

Update comment by auto on 16 Oct 2008 06:28

SSAP job SID9616733048568328 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:10

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:10

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:46

Giving up on SSAP job SID4217409677011040 because submission time of Fri Oct 10 03:16:44 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:46:52 2008).

Update comment by auto on 10 Oct 2008 03:50

SSAP job SID4217409677011040 is not yet finished.

Flow stage update by auto on 10 Oct 2008 03:16

The entry "2k0zA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 03:16

The entry "2k0zA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:38

Retrieved PRC results for job ID SID2323483639720364 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 02:38

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 25 results for 2k0zA00

Update comment by auto on 09 Oct 2008 06:54

PRC job SID2323483639720364 is not yet finished.

Prc cath submit by auto on 09 Oct 2008 06:29

The entry "2k0zA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:29

The entry "2k0zA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:17

Retrieved HMM(SAM) results for job ID SID0795230644515552 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 06:16

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 24 results for 2k0zA00

Update comment by auto on 06 Oct 2008 00:28

HMM(SAM) job SID0795230644515552 is not yet finished.

Sam cath submit by auto on 05 Oct 2008 23:53

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 23:53

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 20:58

Unable to retrieve "2k0zA00" HMM(SAM) results for job "SID3805253942559136"

Update comment by auto on 03 Oct 2008 04:00

HMM(SAM) job SID3805253942559136 is not yet finished.

Flow stage update by auto on 03 Oct 2008 03:38

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 03:38

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:44

Unable to retrieve "2k0zA00" HMM(SAM) results for job "SID1378059647607194"

Update comment by auto on 02 Oct 2008 21:11

HMM(SAM) job SID1378059647607194 is not yet finished.

Flow stage update by auto on 02 Oct 2008 20:49

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 20:49

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:31

Unable to retrieve "2k0zA00" HMM(SAM) results for job "SID0258879718867456"

Update comment by auto on 02 Oct 2008 15:19

HMM(SAM) job SID0258879718867456 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 14:56

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:56

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:17

Unable to retrieve "2k0zA00" HMM(SAM) results for job "SID6101472102814016"

Update comment by auto on 02 Oct 2008 03:56

HMM(SAM) job SID6101472102814016 is not yet finished.

Flow stage update by auto on 02 Oct 2008 03:25

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 03:25

The entry "2k0zA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 02:50

Retrieved "2k0zA00" CATHEDRAL results for job ID SID1035557634881464 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 02:49

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 497 results for 2k0zA00

Update comment by auto on 29 Sep 2008 04:17

"2k0zA00" CATHEDRAL job SID1035557634881464 is not yet finished.

Flow stage update by auto on 29 Sep 2008 04:03

The entry "2k0zA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 29 Sep 2008 04:03

The entry "2k0zA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:45

Giving up on "2k0zA00" CATHEDRAL job SID2385386024177976 because submission time of Mon Sep 22 19:02:58 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:45:25 2008).

Update comment by auto on 22 Sep 2008 19:14

"2k0zA00" CATHEDRAL job SID2385386024177976 is not yet finished.

Flow stage update by auto on 22 Sep 2008 19:02

The entry "2k0zA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Sep 2008 19:02

The entry "2k0zA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:37

Giving up on "2k0zA00" CATHEDRAL job SID4556254348736288 because submission time of Tue Sep 16 15:04:26 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:37:32 2008).

Update comment by auto on 16 Sep 2008 15:16

"2k0zA00" CATHEDRAL job SID4556254348736288 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 15:04

The entry "2k0zA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 15:04

The entry "2k0zA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:48

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2k0zA00.scanlist" for "2k0zA00"

Write scan list by auto on 16 Sep 2008 14:48

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2k0zA00.scanlist" for domain "2k0zA00"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:29

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:21

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 10:00

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:24

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 14:48

Waiting for 507 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 08:51

Waiting for 561 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 08:50

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 08:30

No in_process hits for Domain "2k0zA00" ready to be processed

Flow stage update by auto on 14 Sep 2008 08:30

NW result present for Domain "2k0zA00"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2k0zA00"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2k0zA00"

Insertion by cuff on 10 Sep 2008 11:43

nice chopping