CATH Domain: 2k0mA00 XML data for domain: 2k0mA00

Molscript image for 2k0mA00
2k0mA00
PDB coordinates for domain 2k0mA00

PDB 2k0m, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.17
3.10.450.40.17.1
3.10.450.40.17.1.1
3.10.450.40.17.1.1.1
3.10.450.40.17.1.1.1.1

[top]
Segment boundaries for domain 2k0mA00

Chopping figure for domain 2k0mA00
DomainStart PDB ResidueStop PDB Residue
2k0mA00 1 104

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2k0mA00
MAKAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWI
LRTDGSEERFSYKKCVLEHHHHHH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2k0mA00
MAKAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWI
LRTDGSEERFSYKKCVLEHHHHHH
BLAST against CATH

[top]
Domain History Events (91)

Domain assigned by cuff on 11 Feb 2009 19:51

homology match

Domain assignment manual match h by cuff on 11 Feb 2009 19:50

same superfamily

Homcheck allotment by cuff on 11 Feb 2009 19:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 11 Feb 2009 19:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 12:15

Domain "2k0mA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 12:14

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2k0mA00

Flow stage update by auto on 06 Nov 2008 12:06

Retrieved PRC_PFAMCATH results for job ID SID1369578174308096 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 12:06

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2k0mA00

Update comment by auto on 06 Nov 2008 09:46

PRC_PFAMCATH job SID1369578174308096 is not yet finished.

Flow stage update by auto on 06 Nov 2008 09:42

The entry "2k0mA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 06 Nov 2008 09:42

The entry "2k0mA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 09:31

Retrieved SSAP results for job ID SID2677605029157088 and results inserted.

Domain scan ssap cath by auto on 06 Nov 2008 09:24

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2789 results for 2k0mA00

Update comment by auto on 03 Nov 2008 17:53

SSAP job SID2677605029157088 is not yet finished.

Flow stage update by auto on 03 Nov 2008 17:43

The entry "2k0mA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 03 Nov 2008 17:43

The entry "2k0mA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:38

Giving up on SSAP job SID6411317391110656 because submission time of Tue Oct 28 12:21:01 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:38:30 2008).

Update comment by auto on 28 Oct 2008 12:46

SSAP job SID6411317391110656 is not yet finished.

Flow stage update by auto on 28 Oct 2008 12:21

The entry "2k0mA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 28 Oct 2008 12:21

The entry "2k0mA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 09:07

Giving up on SSAP job SID8476798631590792 because submission time of Wed Oct 22 09:34:14 2008 is more than 518400 seconds older than current time (Tue Oct 28 09:07:12 2008).

Update comment by auto on 22 Oct 2008 09:47

SSAP job SID8476798631590792 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:34

The entry "2k0mA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:34

The entry "2k0mA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:29

Giving up on SSAP job SID7883823054585912 because submission time of Thu Oct 16 06:10:23 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:29:57 2008).

Update comment by auto on 16 Oct 2008 06:28

SSAP job SID7883823054585912 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:10

The entry "2k0mA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:10

The entry "2k0mA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:46

Giving up on SSAP job SID7532281912399440 because submission time of Fri Oct 10 03:16:24 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:46:40 2008).

Update comment by auto on 10 Oct 2008 03:50

SSAP job SID7532281912399440 is not yet finished.

Flow stage update by auto on 10 Oct 2008 03:16

The entry "2k0mA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 03:16

The entry "2k0mA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:37

Retrieved PRC results for job ID SID4189830212724608 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 02:36

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2k0mA00

Update comment by auto on 09 Oct 2008 06:53

PRC job SID4189830212724608 is not yet finished.

Prc cath submit by auto on 09 Oct 2008 06:28

The entry "2k0mA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:28

The entry "2k0mA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 06:16

Retrieved HMM(SAM) results for job ID SID5776881806754176 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 06:15

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2k0mA00

Update comment by auto on 06 Oct 2008 00:28

HMM(SAM) job SID5776881806754176 is not yet finished.

Flow stage update by auto on 05 Oct 2008 23:52

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 05 Oct 2008 23:52

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 20:58

Unable to retrieve "2k0mA00" HMM(SAM) results for job "SID1451687475046304"

Update comment by auto on 03 Oct 2008 04:00

HMM(SAM) job SID1451687475046304 is not yet finished.

Flow stage update by auto on 03 Oct 2008 03:38

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 03:38

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:44

Unable to retrieve "2k0mA00" HMM(SAM) results for job "SID0652863292264812"

Update comment by auto on 02 Oct 2008 21:10

HMM(SAM) job SID0652863292264812 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:48

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:48

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:31

Unable to retrieve "2k0mA00" HMM(SAM) results for job "SID0901038375807962"

Update comment by auto on 02 Oct 2008 15:19

HMM(SAM) job SID0901038375807962 is not yet finished.

Flow stage update by auto on 02 Oct 2008 14:56

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 14:56

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:17

Unable to retrieve "2k0mA00" HMM(SAM) results for job "SID9499139704093696"

Update comment by auto on 02 Oct 2008 03:55

HMM(SAM) job SID9499139704093696 is not yet finished.

Flow stage update by auto on 02 Oct 2008 03:25

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 03:25

The entry "2k0mA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 02:47

Retrieved "2k0mA00" CATHEDRAL results for job ID SID7983227328494316 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 02:47

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 87 results for 2k0mA00

Update comment by auto on 29 Sep 2008 04:17

"2k0mA00" CATHEDRAL job SID7983227328494316 is not yet finished.

Flow stage update by auto on 29 Sep 2008 04:03

The entry "2k0mA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 29 Sep 2008 04:03

The entry "2k0mA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:45

Giving up on "2k0mA00" CATHEDRAL job SID6619668666941328 because submission time of Mon Sep 22 19:02:47 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:45:17 2008).

Update comment by auto on 22 Sep 2008 19:14

"2k0mA00" CATHEDRAL job SID6619668666941328 is not yet finished.

Flow stage update by auto on 22 Sep 2008 19:02

The entry "2k0mA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Sep 2008 19:02

The entry "2k0mA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:37

Giving up on "2k0mA00" CATHEDRAL job SID7682663766720320 because submission time of Tue Sep 16 15:04:14 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:37:23 2008).

Update comment by auto on 16 Sep 2008 15:15

"2k0mA00" CATHEDRAL job SID7682663766720320 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 15:04

The entry "2k0mA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 15:04

The entry "2k0mA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:48

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2k0mA00.scanlist" for "2k0mA00"

Write scan list by auto on 16 Sep 2008 14:48

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2k0mA00.scanlist" for domain "2k0mA00"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:29

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:21

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 10:00

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:24

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 14:48

Waiting for 507 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 08:51

Waiting for 561 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 08:50

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 08:30

No in_process hits for Domain "2k0mA00" ready to be processed

Flow stage update by auto on 14 Sep 2008 08:30

NW result present for Domain "2k0mA00"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2k0mA00"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2k0mA00"

Insertion by cuff on 10 Sep 2008 11:43

nice chopping