Domain assigned by cuff on 23 Feb 2009 17:14
same superfamily
CATH Domain: 2jzcA00
2jzcA00
PDB 2jzc, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2jzcA00 GIIEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPIDQFGCGDT ARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWS CAPTETGLIAGLRASQTEKLKPFPVSHNPSFERLLVETIYS
Domain History Events (91)
Domain assignment manual match h by cuff on 23 Feb 2009 17:13
homology match
Homcheck allotment by cuff on 10 Feb 2009 16:38
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 10 Feb 2009 16:38
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 07 Nov 2008 03:52
Domain "2jzcA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 07 Nov 2008 03:51
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2jzcA00
Flow stage update by auto on 07 Nov 2008 03:50
Retrieved PRC_PFAMCATH results for job ID SID1971244502282464 and results inserted.
Domain scan prc pfamcath by auto on 07 Nov 2008 03:49
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 4 results for 2jzcA00
Update comment by auto on 06 Nov 2008 23:40
PRC_PFAMCATH job SID1971244502282464 is not yet finished.
Flow stage update by auto on 06 Nov 2008 23:38
The entry "2jzcA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 06 Nov 2008 23:38
The entry "2jzcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Nov 2008 23:29
Retrieved SSAP results for job ID SID4758126388341568 and results inserted.
Domain scan ssap cath by auto on 06 Nov 2008 23:25
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1340 results for 2jzcA00
Update comment by auto on 03 Nov 2008 17:52
SSAP job SID4758126388341568 is not yet finished.
Ssap cath submit by auto on 03 Nov 2008 17:42
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 17:42
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 03 Nov 2008 14:38
Giving up on SSAP job SID6991452130562592 because submission time of Tue Oct 28 12:20:55 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:38:26 2008).
Update comment by auto on 28 Oct 2008 12:46
SSAP job SID6991452130562592 is not yet finished.
Ssap cath submit by auto on 28 Oct 2008 12:20
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 12:20
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Oct 2008 09:07
Giving up on SSAP job SID3810317801578848 because submission time of Wed Oct 22 09:34:07 2008 is more than 518400 seconds older than current time (Tue Oct 28 09:07:07 2008).
Update comment by auto on 22 Oct 2008 09:47
SSAP job SID3810317801578848 is not yet finished.
Flow stage update by auto on 22 Oct 2008 09:34
The entry "2jzcA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 22 Oct 2008 09:34
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 22 Oct 2008 06:29
Giving up on SSAP job SID0790701318096392 because submission time of Thu Oct 16 06:10:17 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:29:51 2008).
Update comment by auto on 16 Oct 2008 06:28
SSAP job SID0790701318096392 is not yet finished.
Flow stage update by auto on 16 Oct 2008 06:10
The entry "2jzcA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 16 Oct 2008 06:10
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Oct 2008 03:46
Giving up on SSAP job SID6416409487207936 because submission time of Fri Oct 10 03:16:16 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:46:35 2008).
Update comment by auto on 10 Oct 2008 03:50
SSAP job SID6416409487207936 is not yet finished.
Ssap cath submit by auto on 10 Oct 2008 03:16
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 03:16
The entry "2jzcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 10 Oct 2008 02:36
Retrieved PRC results for job ID SID1486294865710376 and inserted them into the database.
Domain scan prc cath by auto on 10 Oct 2008 02:35
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2jzcA00
Update comment by auto on 09 Oct 2008 06:53
PRC job SID1486294865710376 is not yet finished.
Flow stage update by auto on 09 Oct 2008 06:28
The entry "2jzcA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 09 Oct 2008 06:28
The entry "2jzcA00" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Oct 2008 06:15
Retrieved HMM(SAM) results for job ID SID8305494921333480 and inserted them into the database.
Domain scan sam cath by auto on 09 Oct 2008 06:15
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2jzcA00
Update comment by auto on 06 Oct 2008 00:28
HMM(SAM) job SID8305494921333480 is not yet finished.
Sam cath submit by auto on 05 Oct 2008 23:51
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Oct 2008 23:51
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Oct 2008 20:58
Unable to retrieve "2jzcA00" HMM(SAM) results for job "SID6107189224591684"
Update comment by auto on 03 Oct 2008 04:00
HMM(SAM) job SID6107189224591684 is not yet finished.
Sam cath submit by auto on 03 Oct 2008 03:38
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 03:38
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Oct 2008 00:44
Unable to retrieve "2jzcA00" HMM(SAM) results for job "SID0612987042422036"
Update comment by auto on 02 Oct 2008 21:10
HMM(SAM) job SID0612987042422036 is not yet finished.
Flow stage update by auto on 02 Oct 2008 20:48
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 02 Oct 2008 20:48
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 18:31
Unable to retrieve "2jzcA00" HMM(SAM) results for job "SID7053621072231072"
Update comment by auto on 02 Oct 2008 15:19
HMM(SAM) job SID7053621072231072 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 14:56
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 14:56
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 12:17
Unable to retrieve "2jzcA00" HMM(SAM) results for job "SID1125067601888480"
Update comment by auto on 02 Oct 2008 03:55
HMM(SAM) job SID1125067601888480 is not yet finished.
Sam cath submit by auto on 02 Oct 2008 03:25
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 03:25
The entry "2jzcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 02 Oct 2008 02:47
Retrieved "2jzcA00" CATHEDRAL results for job ID SID5348747046184820 and inserted them into the database.
Domain scan cathedral cath by auto on 02 Oct 2008 02:45
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 464 results for 2jzcA00
Update comment by auto on 29 Sep 2008 04:17
"2jzcA00" CATHEDRAL job SID5348747046184820 is not yet finished.
Flow stage update by auto on 29 Sep 2008 04:03
The entry "2jzcA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 29 Sep 2008 04:03
The entry "2jzcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 28 Sep 2008 20:45
Giving up on "2jzcA00" CATHEDRAL job SID9925687073563576 because submission time of Mon Sep 22 19:02:41 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:45:13 2008).
Update comment by auto on 22 Sep 2008 19:13
"2jzcA00" CATHEDRAL job SID9925687073563576 is not yet finished.
Cathedral cath submit by auto on 22 Sep 2008 19:02
The entry "2jzcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Sep 2008 19:02
The entry "2jzcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Sep 2008 15:37
Giving up on "2jzcA00" CATHEDRAL job SID1535238633242140 because submission time of Tue Sep 16 15:04:09 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:37:19 2008).
Update comment by auto on 16 Sep 2008 15:15
"2jzcA00" CATHEDRAL job SID1535238633242140 is not yet finished.
Cathedral cath submit by auto on 16 Sep 2008 15:04
The entry "2jzcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 16 Sep 2008 15:04
The entry "2jzcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 16 Sep 2008 14:48
ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2jzcA00.scanlist" for "2jzcA00"
Write scan list by auto on 16 Sep 2008 14:47
Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2jzcA00.scanlist" for domain "2jzcA00"
Update comment by auto on 16 Sep 2008 11:22
Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 22:07
Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 17:29
Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 15:21
Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 11:23
Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 10:00
Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Sep 2008 03:26
Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 23:24
Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 21:06
Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 17:36
Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 14:48
Waiting for 507 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Sep 2008 08:51
Waiting for 561 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Flow stage update by auto on 14 Sep 2008 08:50
No satisfactory AssignClose result found.
Flow stage update by auto on 14 Sep 2008 08:30
No in_process hits for Domain "2jzcA00" ready to be processed
Flow stage update by auto on 14 Sep 2008 08:30
NW result present for Domain "2jzcA00"
Flow stage update by auto on 11 Sep 2008 11:06
All required files are present for Domain "2jzcA00"
Flow stage update by auto on 10 Sep 2008 17:44
Beginning processing for Domain "2jzcA00"
Insertion by cuff on 10 Sep 2008 11:51
nice chopping
