CATH Domain: 2jxdA00 XML data for domain: 2jxdA00

Molscript image for 2jxdA00
2jxdA00
PDB coordinates for domain 2jxdA00

PDB 2jxd, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.60 Wheat Germ Agglutinin (Isolectin 2); domain 1
3.30.60.30 Gene3D
3.30.60.30.13
3.30.60.30.13.1
3.30.60.30.13.1.1
3.30.60.30.13.1.1.1
3.30.60.30.13.1.1.1.1

[top]
Segment boundaries for domain 2jxdA00

Chopping figure for domain 2jxdA00
DomainStart PDB ResidueStop PDB Residue
2jxdA00 1 62

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2jxdA00
PQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2jxdA00
PQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 26 Nov 2008 11:25

Assigning to "3.30.60.30" based on similarity with "1cgjI00"

Flow stage update by auto on 26 Nov 2008 11:07

No in_process hits for Domain "2jxdA00" ready to be processed

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "2jxdA00"

Flow stage update by auto on 26 Nov 2008 11:07

All required files are present for Domain "2jxdA00"

Flow stage update by auto on 21 Nov 2008 11:22

Beginning processing for Domain "2jxdA00"

Insertion by auto on 21 Nov 2008 11:09

Final ChopClose added based on similarity with "1cgjI"