CATH Domain: 2js4A01 XML data for domain: 2js4A01

Molscript image for 2js4A01
2js4A01
PDB coordinates for domain 2js4A01

PDB 2js4, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.20
2.20.25.10.20.1
2.20.25.10.20.1.1
2.20.25.10.20.1.1.1
2.20.25.10.20.1.1.1.1

Segment boundaries for domain 2js4A01

Chopping figure for domain 2js4A01
DomainStart PDB ResidueStop PDB Residue
2js4A01 8 54

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2js4A01
ILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLD    

Domain COMBS Sequence

>pdb|2js4A01
ILVCPVCKGRLEFQRAQAELVCNADRLAFPVRDGVPIMLEAEARSLD    

Domain History Events (50)

Domain assigned by cuff on 24 Jul 2008 17:48

same superfamily

Domain assignment manual match h by yan on 17 Jun 2008 12:11

high Ssap score, similar structure

Homcheck review by yan on 17 Jun 2008 12:11

high Ssap score, similar structure

Flow stage update by yan on 17 Jun 2008 12:11

high Ssap score, similar structure

Homcheck allotment by yan on 17 Jun 2008 11:36

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by yan on 17 Jun 2008 11:36

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 24 Feb 2008 17:57

Domain "2js4A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 24 Feb 2008 17:41

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2js4A01

Flow stage update by auto on 24 Feb 2008 17:40

Retrieved PRC_PFAMCATH results for job ID SID8370917179753424 and results inserted.

Domain scan prc pfamcath by auto on 24 Feb 2008 17:39

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 2js4A01

Update comment by auto on 24 Feb 2008 09:00

PRC_PFAMCATH job SID8370917179753424 is not yet finished.

Flow stage update by auto on 24 Feb 2008 08:58

The entry "2js4A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 24 Feb 2008 08:58

The entry "2js4A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Feb 2008 08:56

Retrieved SSAP results for job ID SID6603063824591232 and results inserted.

Domain scan ssap cath by auto on 24 Feb 2008 08:54

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1258 results for 2js4A01

Update comment by auto on 23 Feb 2008 23:48

SSAP job SID6603063824591232 is not yet finished.

Ssap cath submit by auto on 23 Feb 2008 23:35

The entry "2js4A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Feb 2008 23:35

The entry "2js4A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Feb 2008 23:34

Retrieved PRC results for job ID SID4440689441527064 and inserted them into the database.

Domain scan prc cath by auto on 23 Feb 2008 23:34

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2js4A01

Update comment by auto on 23 Feb 2008 12:34

PRC job SID4440689441527064 is not yet finished.

Flow stage update by auto on 23 Feb 2008 12:33

The entry "2js4A01" has been submitted to the PRC webservice.

Prc cath submit by auto on 23 Feb 2008 12:33

The entry "2js4A01" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Feb 2008 12:33

Retrieved HMM(SAM) results for job ID SID8867713588578696 and inserted them into the database.

Domain scan sam cath by auto on 23 Feb 2008 12:33

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2js4A01

Update comment by auto on 22 Feb 2008 21:34

HMM(SAM) job SID8867713588578696 is not yet finished.

Flow stage update by auto on 22 Feb 2008 21:33

The entry "2js4A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 22 Feb 2008 21:33

The entry "2js4A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Feb 2008 21:33

Retrieved "2js4A01" CATHEDRAL results for job ID SID8540947510566740 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Feb 2008 21:32

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 300 results for 2js4A01

Update comment by auto on 22 Feb 2008 05:39

"2js4A01" CATHEDRAL job SID8540947510566740 is not yet finished.

Flow stage update by auto on 22 Feb 2008 05:39

The entry "2js4A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Feb 2008 05:39

ScanList with 11682 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2js4A01.scanlist" for "2js4A01"

Cathedral cath submit by auto on 22 Feb 2008 05:39

The entry "2js4A01" has been submitted to the CATHEDRAL webservice.

Write scan list by auto on 22 Feb 2008 05:39

Writing ScanList containing 11682 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2js4A01.scanlist" for domain "2js4A01"

Update comment by auto on 21 Feb 2008 18:10

Waiting for 2 new domains (example : 1xmbA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Feb 2008 15:21

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Feb 2008 15:08

No in_process hits for Domain "2js4A01" ready to be processed

Update comment by auto on 21 Feb 2008 14:54

Domain "2js4A01" hits Domain "2jr6A01" (55.3191489361702% over 77.0491803278689%) which is currently in process

Update comment by auto on 21 Feb 2008 14:40

Domain "2js4A01" hits Domain "2pk7A01" (48.936170212766% over 75.8064516129032%) which is currently in process

Update comment by auto on 21 Feb 2008 14:25

Domain "2js4A01" hits Domain "2pk7B01" (48.936170212766% over 75.8064516129032%) which is currently in process

Update comment by auto on 21 Feb 2008 14:09

Domain "2js4A01" hits Domain "2hf1B01" (59.5744680851064% over 77.0491803278689%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2js4A01" hits Domain "2hf1A01" (59.5744680851064% over 77.0491803278689%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2js4A01" hits Domain "2hf1A01" (59.5744680851064% over 77.0491803278689%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2js4A01" hits Domain "2hf1A01" (59.5744680851064% over 77.0491803278689%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2js4A01" hits Domain "2hf1A01" (59.5744680851064% over 77.0491803278689%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2js4A01"

Flow stage update by auto on 23 Aug 2007 10:08

All required files are present for Domain "2js4A01"

Flow stage update by auto on 22 Aug 2007 18:23

Beginning processing for Domain "2js4A01"

Insertion by cuff on 22 Aug 2007 17:01

nice chopping