Domain assigned by cuff on 02 Apr 2008 16:40
same superfamily
CATH Domain: 2jq4A00
2jq4A00
PDB 2jq4, Chain A, Domain 0
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1200.10.7.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1qx2A00 | 73.84 | 1.10.238.10 | 75 | 6 | 68 | 3.25 | 4.73 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2jq4A00 MNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLILDGK EAA
Domain History Events (63)
Domain assignment manual match h by cuff on 02 Apr 2008 16:37
ample evidence for homology
Domain assignment manual match t by tronnberg on 20 Sep 2007 13:57
SSAP: 80.3 OV: 90 SEQ: 17. Similar linkage and structure. The query's function is unknown.
Homcheck review by tronnberg on 20 Sep 2007 13:57
SSAP: 80.3 OV: 90 SEQ: 17. Similar linkage and structure. The query's function is unknown.
Flow stage update by tronnberg on 20 Sep 2007 13:57
SSAP: 80.3 OV: 90 SEQ: 17. Similar linkage and structure. The query's function is unknown.
Homcheck allotment by tronnberg on 20 Sep 2007 13:54
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 20 Sep 2007 13:54
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 17 Sep 2007 13:16
Domain "2jq4A00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 17 Sep 2007 13:16
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2jq4A00
Flow stage update by auto on 17 Sep 2007 12:15
Retrieved PRC_PFAMCATH results for job ID SID8986075795536868 and results inserted.
Domain scan prc pfamcath by auto on 17 Sep 2007 12:13
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 18 results for 2jq4A00
Update comment by auto on 16 Sep 2007 22:48
PRC_PFAMCATH job SID8986075795536868 is not yet finished.
Prc pfamcath submit by auto on 16 Sep 2007 22:45
The entry "2jq4A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 16 Sep 2007 22:45
The entry "2jq4A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 16 Sep 2007 22:34
Retrieved SSAP results for job ID SID3602810208684224 and results inserted.
Domain scan ssap cath by auto on 16 Sep 2007 22:31
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2254 results for 2jq4A00
Update comment by auto on 15 Sep 2007 14:27
SSAP job SID3602810208684224 is not yet finished.
Ssap cath submit by auto on 15 Sep 2007 14:18
The entry "2jq4A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 14:18
The entry "2jq4A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 08:26
Giving up on SSAP job SID8915390881241612 because submission time of Sun Sep 9 22:50:46 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:26:11 2007).
Update comment by auto on 09 Sep 2007 23:29
SSAP job SID8915390881241612 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:50
The entry "2jq4A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:50
The entry "2jq4A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:21
Giving up on SSAP job SID6378483294837568 because submission time of Wed Sep 5 19:00:48 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:21:31 2007).
Update comment by auto on 05 Sep 2007 20:04
SSAP job SID6378483294837568 is not yet finished.
Flow stage update by auto on 05 Sep 2007 19:00
The entry "2jq4A00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 05 Sep 2007 19:00
The entry "2jq4A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 14:20
Retrieved PRC results for job ID SID3541257248984544 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 14:18
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 18 results for 2jq4A00
Flow stage update by auto on 05 Sep 2007 04:36
The entry "2jq4A00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 04:36
The entry "2jq4A00" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 02:03
Retrieved HMM(SAM) results for job ID SID8585277497768064 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 02:03
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 2jq4A00
Update comment by auto on 04 Sep 2007 13:29
HMM(SAM) job SID8585277497768064 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:36
The entry "2jq4A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:36
The entry "2jq4A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 07:55
Retrieved "2jq4A00" CATHEDRAL results for job ID SID9255295110461088 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 07:54
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 132 results for 2jq4A00
Cathedral cath submit by auto on 03 Sep 2007 14:37
The entry "2jq4A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:37
The entry "2jq4A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:54
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2jq4A00.scanlist" for "2jq4A00"
Write scan list by auto on 03 Sep 2007 12:54
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2jq4A00.scanlist" for domain "2jq4A00"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:32
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:33
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:23
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:23
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:16
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:29
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:13
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:16
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:42
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:17
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:34
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:08
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 20:02
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2jq4A00" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2jq4A00"
Flow stage update by auto on 23 Aug 2007 10:08
All required files are present for Domain "2jq4A00"
Flow stage update by auto on 22 Aug 2007 18:23
Beginning processing for Domain "2jq4A00"
Insertion by cuff on 22 Aug 2007 17:01
nice chopping
