Domain assigned by cuff on 18 Feb 2008 11:58
same superfamily
CATH Domain: 2jmpA01
2jmpA01
PDB 2jmp, Chain A, Domain 1
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2jmpA01 MEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDF FFNLAKL
Domain History Events (56)
Domain assignment manual match h by cuff on 18 Feb 2008 11:57
similar function and structure
Homcheck review by tronnberg on 10 Sep 2007 12:33
SSAP: 75.51 OV: 83 SEQ: 9. Similar linkage and reasonable similar structure. The function for the query is unknown.
Flow stage update by tronnberg on 10 Sep 2007 12:33
SSAP: 75.51 OV: 83 SEQ: 9. Similar linkage and reasonable similar structure. The function for the query is unknown.
Domain assignment manual match t by tronnberg on 10 Sep 2007 12:33
SSAP: 75.51 OV: 83 SEQ: 9. Similar linkage and reasonable similar structure. The function for the query is unknown.
Domain assignment manual match t by tronnberg on 10 Sep 2007 12:33
SSAP: 75.51 OV: 83 SEQ: 9. Similar linkage and reasonable similar structure. The function for the query is unknown.
Homcheck allotment by tronnberg on 10 Sep 2007 12:29
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Sep 2007 12:29
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Sep 2007 11:53
Domain "2jmpA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Sep 2007 11:52
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2jmpA01
Flow stage update by auto on 09 Sep 2007 11:43
Retrieved PRC_PFAMCATH results for job ID SID8480868127033140 and results inserted.
Domain scan prc pfamcath by auto on 09 Sep 2007 11:42
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2jmpA01
Update comment by auto on 09 Sep 2007 08:36
PRC_PFAMCATH job SID8480868127033140 is not yet finished.
Flow stage update by auto on 09 Sep 2007 08:19
The entry "2jmpA01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 09 Sep 2007 08:19
The entry "2jmpA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Sep 2007 07:10
Retrieved SSAP results for job ID SID2663021810993952 and results inserted.
Domain scan ssap cath by auto on 09 Sep 2007 07:04
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1439 results for 2jmpA01
Update comment by auto on 05 Sep 2007 19:32
SSAP job SID2663021810993952 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 16:03
The entry "2jmpA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 16:03
The entry "2jmpA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 08:28
Retrieved PRC results for job ID SID9334605566206592 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 08:27
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2jmpA01
Prc cath submit by auto on 05 Sep 2007 03:41
The entry "2jmpA01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:41
The entry "2jmpA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 17:12
Retrieved HMM(SAM) results for job ID SID7954953458449392 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 17:11
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2jmpA01
Update comment by auto on 04 Sep 2007 11:45
HMM(SAM) job SID7954953458449392 is not yet finished.
Flow stage update by auto on 04 Sep 2007 09:52
The entry "2jmpA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 09:52
The entry "2jmpA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 00:32
Retrieved "2jmpA01" CATHEDRAL results for job ID SID8778256841050304 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 00:30
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 234 results for 2jmpA01
Flow stage update by auto on 03 Sep 2007 13:59
The entry "2jmpA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 13:59
The entry "2jmpA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:57
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2jmpA01.scanlist" for "2jmpA01"
Write scan list by auto on 03 Sep 2007 11:57
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2jmpA01.scanlist" for domain "2jmpA01"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:31
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:32
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:21
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:27
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:14
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:31
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:59
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2jmpA01" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2jmpA01"
Flow stage update by auto on 23 Aug 2007 10:08
All required files are present for Domain "2jmpA01"
Flow stage update by auto on 22 Aug 2007 18:23
Beginning processing for Domain "2jmpA01"
Insertion by cuff on 22 Aug 2007 17:01
nice chopping
