CATH Domain: 2jmfA01 XML data for domain: 2jmfA01

Molscript image for 2jmfA01
2jmfA01
PDB coordinates for domain 2jmfA01

PDB 2jmf, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.70 Ubiquitin Ligase Nedd4; Chain: W;
2.20.70.10 Gene3D
2.20.70.10.7
2.20.70.10.7.2
2.20.70.10.7.2.1
2.20.70.10.7.2.1.1
2.20.70.10.7.2.1.1.1

[top]
Segment boundaries for domain 2jmfA01

Chopping figure for domain 2jmfA01
DomainStart PDB ResidueStop PDB Residue
2jmfA01 523 557

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.20.70.10.7.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2dmvA01 89.74 E3 ubiquitin-protein ligase Itchy homologHomo sapiensProtein bindingEntry of virus into host cell 2.20.70.10 36 48 91 1.72 1.88
1o6wA01 88.01 U2-type prespliceosomeRNA bindingPre-mRNA-processing factor 40Nuclear mRNA splicing, via spliceosomeProtein binding 2.20.70.10 26 34 78 1.40 1.78
1tk7A02 85.03 Atrophin-1 interacting protein 5 (WW domain containing E3 ubiquitin protein ligase 1) [EC:6.3.2.19]Wing disc dorsal/ventral pattern formationImaginal disc-derived wing vein morphogenesisImaginal disc-derived wing margin morphogenesisDrosophila melanogaster 2.20.70.10 29 55 81 1.50 1.83
1k5rA00 81.59 CytoplasmTranscription corepressor activityNucleusHomo sapiensYorkie homolog 2.20.70.10 39 48 79 2.01 2.53
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2jmfA01
LPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2jmfA01
LPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAP
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 26 Nov 2007 18:28

Assigning to "2.20.70.10" based on similarity with "1wr7A01"

Flow stage update by auto on 26 Nov 2007 18:16

No in_process hits for Domain "2jmfA01" ready to be processed

Flow stage update by auto on 26 Nov 2007 18:16

NW result present for Domain "2jmfA01"

Flow stage update by auto on 24 Nov 2007 14:37

All required files are present for Domain "2jmfA01"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2jmfA01"

Insertion by auto on 23 Nov 2007 10:22

Final ChopClose added based on similarity with "2ez5W"