CATH Domain: 2jkhA01 XML data for domain: 2jkhA01

Molscript image for 2jkhA01
2jkhA01
PDB coordinates for domain 2jkhA01

PDB 2jkh, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.10 Thrombin, subunit H
2.40.10.10 Trypsin-like serine proteases Gene3D
2.40.10.10.3
2.40.10.10.3.4
2.40.10.10.3.4.1
2.40.10.10.3.4.1.1
2.40.10.10.3.4.1.1.1

[top]
Segment boundaries for domain 2jkhA01

Chopping figure for domain 2jkhA01
DomainStart PDB ResidueStop PDB Residue
2jkhA01 16 27
2jkhA01 121 232
2jkhA02 28 120
2jkhA02 233 244

Structural Neighbourhood (28 entries)

There are 28 matching structural neighberhood comparisons for CATH ID 2.40.10.10.3.4.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 28 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eaxA01 92.57 Suppressor of tumorigenicity protein 14 [EC:3.4.21.109]Integral to plasma membraneSuppressor of tumorigenicity 14 proteinHomo sapiensProteolysis 2.40.10.10 126 40 96 1.16 1.20
2o8tA01 91.85 Regulation of smooth muscle cell migrationCell surfaceUrokinase-type plasminogen activatorSignal transductionProteolysis 2.40.10.10 128 38 96 1.30 1.35
1hj9A01 91.72 Neuroactive ligand-receptor interactionBos taurusCationic trypsinTrypsin [EC:3.4.21.4]Protein binding 2.40.10.10 120 45 96 1.57 1.62
1bioA01 91.40 Serine-type endopeptidase activityHomo sapiensComponent factor D [EC:3.4.21.46]Complement and coagulation cascadesComplement factor D 2.40.10.10 122 34 95 1.44 1.50
1gvkB01 91.05 Sus scrofaChymotrypsin-like elastase family member 1Protein binding 2.40.10.10 128 32 94 1.09 1.15
2bvrH01 90.64 FibrinolysisSerine-type endopeptidase activityProthrombinSoluble fractionPositive regulation of protein phosphorylation 2.40.10.10 132 39 91 1.93 2.11
1eq9A01 90.57 Chymotrypsin-1Solenopsis invicta 2.40.10.10 117 32 94 1.44 1.53
1k2i101 90.40 Bos taurusChymotrypsinogen A 2.40.10.10 118 38 92 1.64 1.77
1q3xA02 90.34 Serine-type endopeptidase activityHomo sapiensMannan-binding lectin serine protease 2Calcium-dependent protein bindingComplement activation, lectin pathway 2.40.10.10 137 41 89 1.89 2.12
2asuB01 89.60 Hepatocyte growth factor-like proteinHomo sapiens 2.40.10.10 122 23 95 2.17 2.28
2hlcA02 89.35 CollagenaseHypoderma lineatum 2.40.10.10 126 31 92 1.82 1.96
3gylB01 88.99 ProstasinPlasma membraneProtease, serine, 8 (prostasin) [EC:3.4.21.-]Homo sapiensExtracellular space 2.40.10.10 133 41 92 2.06 2.23
1a7sA01 88.80 AzurocidinPositive regulation of phagocytosisAzurophil granuleMonocyte activationPositive regulation of tumor necrosis factor biosynthetic process 2.40.10.10 112 30 89 1.53 1.71
1elvA02 88.70 Serine-type endopeptidase activitySystemic lupus erythematosusComplement C1s subcomponentHomo sapiensComplement component 1, s subcomponent [EC:3.4.21.42] 2.40.10.10 126 30 92 2.34 2.54
1si5H01 88.06 Pathways in cancerHepatocyte growth factorEpithelial to mesenchymal transitionRenal cell carcinomaCytokine-cytokine receptor interaction 2.40.10.10 119 28 92 2.06 2.22
1gvzA01 85.63 Equus caballusKallikrein-1E2 2.40.10.10 121 28 96 2.73 2.82
1yphE00 83.58 Bos taurusChymotrypsinogen A 2.40.10.10 97 36 65 1.63 2.50
1nn6A01 83.42 ChymaseChymase [EC:3.4.21.39]Homo sapiensRenin-angiotensin systemInterleukin-1 beta biosynthetic process 2.40.10.10 114 23 91 2.79 3.03
2o8lA01 82.88 Glutamyl endopeptidase [EC:3.4.21.19]Glutamyl endopeptidaseStaphylococcus aureus subsp. aureus Mu50 2.40.10.10 115 11 74 2.34 3.15
1y8tB02 81.60 Two-component systemPutative serine protease PepD [EC:3.4.21.-]PROBABLE SERINE PROTEASE PEPD (SERINE PROTEINASE) (MTB32B)Mycobacterium tuberculosis 2.40.10.10 111 13 68 2.26 3.30
1arbA01 81.27 Achromobacter lyticusProtease 1 2.40.10.10 122 12 86 3.53 4.09
1p3cA01 81.09 Glutamyl-endopeptidaseBacillus intermedius 2.40.10.10 102 14 77 3.24 4.18
2qf3B02 80.88 Protease degSProtein bindingSerine protease DegS [EC:3.4.21.-]Escherichia coli K-12 2.40.10.10 103 12 72 3.01 4.15
1lcyA02 79.92 Serine-type endopeptidase activityHtrA serine peptidase 2 [EC:3.4.21.108]Endoplasmic reticulum membraneParkinson's diseaseNucleus 2.40.10.10 84 14 66 3.10 4.69
1dleB02 78.66 Complement factor BComplement bindingHomo sapiensComponent factor B [EC:3.4.21.47]Complement and coagulation cascades 2.40.10.10 142 17 70 2.73 3.88
2j92A02 78.61 Foot-and-mouth disease virus (strain A10-61)Genome polyprotein 2.40.10.10 109 11 67 2.70 3.99
1svpA02 73.28 Sindbis virusStructural polyprotein 2.40.10.10 86 12 56 2.45 4.34
3fanA02 72.50 Porcine reproductive and respiratory syndrome virusNon-structural protein 2.40.10.10 69 15 50 2.28 4.49
[1]
Displaying entries 1 to 28 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2jkhA01
IVGGQECKDGECACLPERDWAESTLMTQKTGIVSGFGRTHEKGEQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYD
TKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2jkhA01
IVGGQECKDGECACLPERDWAESTLMTQKTGIVSGFGRTHEKGEQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYD
TKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVT
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 20 Jan 2009 21:26

Assigning to "2.40.10.10" based on similarity with "2bokA01"

Flow stage update by auto on 20 Jan 2009 21:26

No in_process hits for Domain "2jkhA01" ready to be processed

Update comment by auto on 20 Jan 2009 21:23

Domain "2jkhA01" hits Domain "2ziqH01" (48.4375% over 92.0863309352518%) which is currently in process

Update comment by auto on 20 Jan 2009 21:20

Domain "2jkhA01" hits Domain "2zi2H01" (48.4375% over 92.0863309352518%) which is currently in process

Update comment by auto on 20 Jan 2009 21:12

Domain "2jkhA01" hits Domain "2zhqH01" (48.4375% over 92.0863309352518%) which is currently in process

Update comment by auto on 20 Jan 2009 21:09

Domain "2jkhA01" hits Domain "2zftA01" (46.6666666666667% over 92.96875%) which is currently in process

Update comment by auto on 20 Jan 2009 21:03

Domain "2jkhA01" hits Domain "2zfsA01" (46.6666666666667% over 92.96875%) which is currently in process

Update comment by auto on 20 Jan 2009 20:52

Domain "2jkhA01" hits Domain "2zfrH01" (48.4375% over 92.0863309352518%) which is currently in process

Update comment by auto on 20 Jan 2009 18:32

Domain "2jkhA01" hits Domain "2zfqH01" (48.4375% over 92.0863309352518%) which is currently in process

Flow stage update by auto on 20 Jan 2009 18:07

Domain "2jkhA01" hits Domain "2zfqH01" (48.4375% over 92.0863309352518%) which is currently in process

Flow stage update by auto on 20 Jan 2009 18:07

NW result present for Domain "2jkhA01"

Flow stage update by auto on 20 Jan 2009 10:29

All required files are present for Domain "2jkhA01"

Flow stage update by auto on 19 Jan 2009 15:51

Beginning processing for Domain "2jkhA01"

Insertion by auto on 19 Jan 2009 14:24

Final ChopClose added based on similarity with "2bokA"