CATH Domain: 2j8gA03 XML data for domain: 2j8gA03

Molscript image for 2j8gA03
2j8gA03
PDB coordinates for domain 2j8gA03

PDB 2j8g, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.120 Multimodular pneumococcal cell wall endolysin, domain 3
2.20.120.10 Multimodular pneumococcal cell wall endolysin, domain 3 Gene3D
2.20.120.10.1
2.20.120.10.1.1
2.20.120.10.1.1.1
2.20.120.10.1.1.1.1
2.20.120.10.1.1.1.1.1

[top]
Segment boundaries for domain 2j8gA03

Chopping figure for domain 2j8gA03
DomainStart PDB ResidueStop PDB Residue
2j8gA01 2 188
2j8gA02 200 281
2j8gA03 282 339

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2j8gA03
TGWVKYKNNWYYMTNERGNMVSNEFIKSGKGWYFMNTNGELADNPSFTKEPDGLITVA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2j8gA03
TGWVKYKNNWYYMTNERGNMVSNEFIKSGKGWYFMNTNGELADNPSFTKEPDGLITVA
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Aug 2007 00:54

Assigning to "2.20.120.10" based on similarity with "1h09A03"

Flow stage update by auto on 15 Aug 2007 00:08

No in_process hits for Domain "2j8gA03" ready to be processed

Update comment by auto on 14 Aug 2007 22:51

Domain "2j8gA03" hits Domain "2ixvA03" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 23:06

Domain "2j8gA03" hits Domain "2j8fA03" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 23:06

NW result present for Domain "2j8gA03"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2j8gA03"

Flow stage update by auto on 14 Jul 2007 17:56

Beginning processing for Domain "2j8gA03"

Insertion by auto on 14 Jul 2007 16:37

Final ChopClose added based on similarity with "2ixvA"