CATH Domain: 2j8gA02 XML data for domain: 2j8gA02

Molscript image for 2j8gA02
2j8gA02
PDB coordinates for domain 2j8gA02

PDB 2j8g, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.10 Ribbon
2.10.270 left handed beta-beta-3-solenoid
2.10.270.10 Cholin Binding Gene3D
2.10.270.10.1
2.10.270.10.1.1
2.10.270.10.1.1.1
2.10.270.10.1.1.1.1
2.10.270.10.1.1.1.1.1

[top]
Segment boundaries for domain 2j8gA02

Chopping figure for domain 2j8gA02
DomainStart PDB ResidueStop PDB Residue
2j8gA01 2 188
2j8gA02 200 281
2j8gA03 282 339

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.10.270.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1h8gA00 83.72 N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]AutolysinStreptococcus pneumoniae 2.10.270.10 92 21 79 3.80 4.79
2bmlA00 83.02 N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]AutolysinStreptococcus pneumoniae 2.10.270.10 125 31 64 1.59 2.48
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2j8gA02
GTWKQDSKGWWFRRNNGSFPYNKWEKIGGVWYYFDSKGYCLTSEWLKDNEKWYYLKDNGAMATGWVLVGSEWYYMDDSGA
MV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2j8gA02
GTWKQDSKGWWFRRNNGSFPYNKWEKIGGVWYYFDSKGYCLTSEWLKDNEKWYYLKDNGAMATGWVLVGSEWYYMDDSGA
MV
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Aug 2007 00:54

Assigning to "2.10.270.10" based on similarity with "1h09A02"

Flow stage update by auto on 15 Aug 2007 00:08

No in_process hits for Domain "2j8gA02" ready to be processed

Update comment by auto on 14 Aug 2007 22:51

Domain "2j8gA02" hits Domain "2ixvA02" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 23:06

Domain "2j8gA02" hits Domain "2j8fA02" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 23:06

NW result present for Domain "2j8gA02"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2j8gA02"

Flow stage update by auto on 14 Jul 2007 17:56

Beginning processing for Domain "2j8gA02"

Insertion by auto on 14 Jul 2007 16:37

Final ChopClose added based on similarity with "2ixvA"