CATH Domain: 2j5gK00

2j5gK00

PDB 2j5g, Chain K, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.90	Alpha-Beta Complex
3.90.226	2-enoyl-CoA Hydratase; Chain A, domain 1
3.90.226.10	2-enoyl-CoA Hydratase; Chain A, domain 1	Gene3D
3.90.226.10.7
3.90.226.10.7.1
3.90.226.10.7.1.1
3.90.226.10.7.1.1.1
3.90.226.10.7.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2j5gK00

Domain	Start PDB Residue	Stop PDB Residue
2j5gK00	5	252

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.90.226.10.7.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3kqfA01	84.28	Fatty acid metabolismValine, leucine and isoleucine degradationLimonene and pinene degradationPropanoate metabolismMetabolic pathways	3.90.226.10	195	25	77	2.15	2.76
1hnuA00	84.19	Dodecenoyl-CoA delta-isomerase activityPeroxisomeSaccharomyces cerevisiaeFatty acid beta-oxidation3,2-trans-enoyl-CoA isomerase	3.90.226.10	248	12	94	2.68	2.84
3h81A01	84.04	Fatty acid metabolismGeraniol degradationValine, leucine and isoleucine degradationLimonene and pinene degradationPropanoate metabolism	3.90.226.10	198	22	79	2.30	2.90
3g64A01	83.12	Fatty acid metabolismGeraniol degradationValine, leucine and isoleucine degradationLimonene and pinene degradationPropanoate metabolism	3.90.226.10	211	20	81	2.74	3.35
1uiyA01	82.31	Enoyl-CoA hydrataseThermus thermophilus	3.90.226.10	194	22	77	2.30	2.99
1ef8A02	79.23	Propanoate metabolismMethylmalonyl-CoA decarboxylase [EC:4.1.1.41]Methylmalonyl-CoA decarboxylase activityMethylmalonyl-CoA decarboxylaseEscherichia coli K-12	3.90.226.10	179	16	70	2.77	3.90

[top]
Domain ATOM Sequence

>pdb|2j5gK00
QPEYFTKYENLHFHRDENGILEVRMHTNGSSLVFTGKTHREFPDAFYDISRDRDNRVVILTGSGDAWMAEIDFPSLGDVT
NPREWDKTYWEGKKVLQNLLDIEVPVISAVNGAALLHSEYILTTDIILASENTVFQDMPHLNAGIVPGDGVHILWPLALG
LYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVALTQRLKRLVNEGIGYGLALEG
ITATDLRN

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2j5gK00
MGSSHHHHHHMTLNQPEYFTKYENLHFHRDENGILEVRMHTNGSSLVFTGKTHREFPDAFYDISRDRDNRVVILTGSGDA
WMAEIDFPSLGDVTNPREWDKTYWEGKKVLQNLLDIEVPVISAVNGAALLHSEYILTTDIILASENTVFQDMPHLNAGIV
PGDGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVALTQRLKR
LVNEGIGYGLALEGITATDLRNT

BLAST against CATH

[top]
Domain History Events (30)

Domain assigned by auto on 20 Oct 2008 15:04

Assigning to "3.90.226.10" based on similarity with "2j5gB00"

Flow stage update by auto on 20 Oct 2008 15:04

No in_process hits for Domain "2j5gK00" ready to be processed

Update comment by auto on 20 Oct 2008 15:02

Domain "2j5gK00" hits Domain "2j5gJ00" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 15:00

Domain "2j5gK00" hits Domain "2j5gB00" (100% over 100%) which is currently in process

Update comment by auto on 20 Oct 2008 14:58

Domain "2j5gK00" hits Domain "1szoE00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:56

Domain "2j5gK00" hits Domain "1szoI00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:54

Domain "2j5gK00" hits Domain "1szoL00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:52

Domain "2j5gK00" hits Domain "1szoB00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:50

Domain "2j5gK00" hits Domain "1szoD00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:48

Domain "2j5gK00" hits Domain "1szoA00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:46

Domain "2j5gK00" hits Domain "1szoG00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:44

Domain "2j5gK00" hits Domain "1szoC00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:42

Domain "2j5gK00" hits Domain "1szoF00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:40

Domain "2j5gK00" hits Domain "1szoJ00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:38

Domain "2j5gK00" hits Domain "1szoH00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:36

Domain "2j5gK00" hits Domain "1szoK00" (46.3035019455253% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:33

Domain "2j5gK00" hits Domain "1o8uD00" (46.692607003891% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:31

Domain "2j5gK00" hits Domain "1o8uF00" (46.692607003891% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:29

Domain "2j5gK00" hits Domain "1o8uE00" (46.692607003891% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:27

Domain "2j5gK00" hits Domain "1o8uC00" (46.692607003891% over 96.5779467680608%) which is currently in process

Update comment by auto on 20 Oct 2008 14:18

Domain "2j5gK00" hits Domain "1o8uB00" (46.692607003891% over 96.5779467680608%) which is currently in process