Flow stage update by auto on 12 Jan 2007 15:45
No in_process hits for Domain "2j45A02" ready to be processed
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2j45A01 | 2 | 90 |
| 2j45A02 | 91 | 281 |
There are 9 matching structural neighberhood comparisons for CATH ID 3.40.50.300.4.1.1.1.1 (SIMAX score < 5)
>pdb|2j45A02 RLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRR RVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGD ARGGAALSARHVTGKPIYFAGVSEKPEGLEP
No in_process hits for Domain "2j45A02" ready to be processed
Domain "2j45A02" hits Domain "2j45B02" (100% over 100%) which is currently in process
Domain "2j45A02" hits Domain "2j46A02" (100% over 100%) which is currently in process
Domain "2j45A02" hits Domain "2j46B02" (100% over 100%) which is currently in process
Domain "2j45A02" hits Domain "2j46B02" (100% over 100%) which is currently in process
NW result present for Domain "2j45A02"
All required files are present for Domain "2j45A02"
Beginning processing for Domain "2j45A02"
Final ChopClose added based on similarity with "1o87A"