Domain assigned by auto on 16 Dec 2006 23:37
Assigning to "3.30.200.20" based on similarity with "2cdzA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2j0iA01 | 300 | 397 |
| 2j0iA02 | 398 | 589 |
There are 47 matching structural neighberhood comparisons for CATH ID 3.30.200.20.14.1.1.1.1 (SIMAX score < 5)
>pdb|2j0iA01 SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV EMYNSYLVGDELWVVMEF
Assigning to "3.30.200.20" based on similarity with "2cdzA01"
No in_process hits for Domain "2j0iA01" ready to be processed
NW result present for Domain "2j0iA01"
All required files are present for Domain "2j0iA01"
Beginning processing for Domain "2j0iA01"
another batch of choppings