Domain assigned by auto on 22 Dec 2006 23:35
Assigning to "3.30.200.20" based on similarity with "2chlA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2izrA01 | 36 | 119 |
| 2izrA02 | 120 | 334 |
There are 60 matching structural neighberhood comparisons for CATH ID 3.30.200.20.5.1.1.1.1 (SIMAX score < 5)
>pdb|2izrA01 VLMVGPNFRVGKKIGCNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVL ELL
Assigning to "3.30.200.20" based on similarity with "2chlA01"
No in_process hits for Domain "2izrA01" ready to be processed
NW result present for Domain "2izrA01"
All required files are present for Domain "2izrA01"
Beginning processing for Domain "2izrA01"
Final ChopClose added based on similarity with "2iztA"