CATH Domain: 2iz1A03 XML data for domain: 2iz1A03

Molscript image for 2iz1A03
2iz1A03
PDB coordinates for domain 2iz1A03

PDB 2iz1, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.320 6-Phosphogluconate Dehydrogenase, domain 3 Gene3D
1.20.5.320.1
1.20.5.320.1.1
1.20.5.320.1.1.4
1.20.5.320.1.1.4.1
1.20.5.320.1.1.4.1.1

[top]
Segment boundaries for domain 2iz1A03

Chopping figure for domain 2iz1A03
DomainStart PDB ResidueStop PDB Residue
2iz1A01 1 181
2iz1A02 182 436
2iz1A03 437 470

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.20.5.320.1.1.4.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pgdA03 93.26 Ovis aries6-phosphogluconate dehydrogenase, decarboxylating 1.20.5.320 38 64 89 1.13 1.26
1pgjA03 92.32 6-phosphogluconate dehydrogenase, decarboxylatingTrypanosoma brucei brucei 1.20.5.320 34 38 94 1.47 1.56
1vq8P02 73.96 50S ribosomal protein L19eRibosomeLarge subunit ribosomal protein L19eHaloarcula marismortui 1.20.5.560 33 6 58 2.82 4.79
2i8dA02 73.82 Hypothetical proteinLactobacillus casei ATCC 334Putative uncharacterized protein 1.20.5.420 30 0 50 2.40 4.80
1mkmA02 71.79 Thermotoga maritimaTranscriptional regulator, IclR family 1.20.5.640 14 0 41 0.88 2.14
2idbA03 71.65 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathways3-octaprenyl-4-hydroxybenzoate carboxy-lyase activity3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC:4.1.1.-]3-octaprenyl-4-hydroxybenzoate carboxy-lyase 1.20.5.570 34 2 55 2.65 4.74
1kilE00 67.96 Complexin-1Syntaxin-1 bindingRattus norvegicusDendriteSynaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex 1.20.5.580 41 11 39 1.79 4.59
3e7kA00 61.15 Rattus norvegicusCalcium channel activityCalcium ion transportIntegral to membraneProtein binding 1.20.5.1010 54 2 27 1.30 4.68
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2iz1A03
NLPANLIQAQRDYFGAHTYERTDKAGIFHYDWYT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2iz1A03
NLPANLIQAQRDYFGAHTYERTDKAGIFHYDWYTED
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 15 Aug 2007 03:38

Assigning to "1.20.5.320" based on similarity with "2iyoA03"

Flow stage update by auto on 15 Aug 2007 03:21

No in_process hits for Domain "2iz1A03" ready to be processed

Update comment by auto on 15 Aug 2007 02:39

Domain "2iz1A03" hits Domain "2iz0C03" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:38

Domain "2iz1A03" hits Domain "2iz0B03" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:07

Domain "2iz1A03" hits Domain "2iypA03" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:50

Domain "2iz1A03" hits Domain "2iyoA03" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 15:55

Domain "2iz1A03" hits Domain "2iypC03" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 15:55

NW result present for Domain "2iz1A03"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2iz1A03"

Flow stage update by auto on 15 Jul 2007 11:36

Beginning processing for Domain "2iz1A03"

Insertion by auto on 15 Jul 2007 10:32

Final ChopClose added based on similarity with "2iz0A"