CATH Domain: 2iv2X01 XML data for domain: 2iv2X01

Molscript image for 2iv2X01
2iv2X01
PDB coordinates for domain 2iv2X01

PDB 2iv2, Chain X, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.90 ADC-like domains Gene3D
2.20.25.90.2
2.20.25.90.2.1
2.20.25.90.2.1.1
2.20.25.90.2.1.1.1
2.20.25.90.2.1.1.1.1

[top]
Segment boundaries for domain 2iv2X01

Chopping figure for domain 2iv2X01
DomainStart PDB ResidueStop PDB Residue
2iv2X01 1 55
2iv2X02 61 137
2iv2X02 336 526
2iv2X03 138 332
2iv2X04 572 688

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.20.25.90.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vpzA01 86.40 Thermus thermophilus HB27Thiosulfate reductase [EC:1.-.-.-]Thiosulfate reductase 2.20.25.90 67 21 82 1.55 1.89
1q16A03 82.97 Nitrogen metabolismTwo-component systemProtein bindingRespiratory nitrate reductase 1 alpha chainEscherichia coli K-12 2.20.25.90 47 14 69 2.03 2.94
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2iv2X01
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2iv2X01
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDT
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 28 Apr 2008 17:23

Assigning to "2.20.25.90" based on similarity with "1aa6A01"

Flow stage update by auto on 28 Apr 2008 17:22

No in_process hits for Domain "2iv2X01" ready to be processed

Update comment by auto on 28 Apr 2008 17:21

Domain "2iv2X01" hits Domain "1fdiA01" (100% over 94.8275862068966%) which is currently in process

Update comment by auto on 28 Apr 2008 17:14

Domain "2iv2X01" hits Domain "1fdoA01" (100% over 94.8275862068966%) which is currently in process

Update comment by auto on 13 Nov 2007 00:25

Domain "2iv2X01" hits Domain "1aa6A01" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:18

Domain "2iv2X01" hits Domain "1aa6001" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:24

Domain "2iv2X01" hits Domain "1aa6001" (100% over 100%) which is currently in process

Update comment by auto on 27 Aug 2007 14:10

Domain "2iv2X01" hits Domain "1aa6001" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 14:04

Domain "2iv2X01" hits Domain "1aa6001" (100% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 14:04

NW result present for Domain "2iv2X01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2iv2X01"

Flow stage update by auto on 18 Aug 2007 20:23

Beginning processing for Domain "2iv2X01"

Insertion by auto on 18 Aug 2007 18:09

Final ChopClose added based on similarity with "1aa60"