CATH Domain: 2iugA00

2iugA00

PDB 2iug, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.505	SHC Adaptor Protein
3.30.505.10	SHC Adaptor Protein	Gene3D
3.30.505.10.15
3.30.505.10.15.1
3.30.505.10.15.1.1
3.30.505.10.15.1.1.1
3.30.505.10.15.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2iugA00

Domain	Start PDB Residue	Stop PDB Residue
2iugA00	3	112

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.505.10.15.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2crhA01	88.17	Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis	3.30.505.10	102	28	92	2.35	2.53
1milA00	87.18	Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding	3.30.505.10	104	27	94	2.62	2.77
1i3zA00	86.62	Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding	3.30.505.10	102	22	86	2.20	2.55
2vifA01	86.31	CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6	3.30.505.10	126	33	84	1.85	2.18
2kk6A00	85.96	CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer	3.30.505.10	116	30	90	3.35	3.70
2dm0A01	85.12	Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens	3.30.505.10	97	26	80	2.16	2.67
1ju5A00	83.79	Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway	3.30.505.10	109	26	82	2.23	2.70
3cxlA01	81.85	N-chimaerinHomo sapiensSH3/SH2 adaptor activity	3.30.505.10	104	21	80	3.58	4.42
2pldA00	81.75	Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway	3.30.505.10	105	25	92	4.17	4.50
1uurA04	80.15	Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol	3.30.505.10	132	12	68	3.03	4.44
1bg1A04	77.22	Positive regulation of transcription from RNA polymerase II promoterTemperature homeostasisRegulation of multicellular organism growthNucleusPlasma membrane	3.30.505.10	109	17	75	3.75	4.97

[top]
Domain ATOM Sequence

>pdb|2iugA00
NNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVE
LINHYRNESLAQYNPKLDVKLLYPVSKYQQ

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2iugA00
GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS
VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED

BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:36

Assigning to "3.30.505.10" based on similarity with "2iuhA00"