CATH Domain: 2itbB00 XML data for domain: 2itbB00

Molscript image for 2itbB00
2itbB00
PDB coordinates for domain 2itbB00

PDB 2itb, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.25
1.20.1260.10.25.1
1.20.1260.10.25.1.1
1.20.1260.10.25.1.1.1
1.20.1260.10.25.1.1.1.1

Segment boundaries for domain 2itbB00

Chopping figure for domain 2itbB00
DomainStart PDB ResidueStop PDB Residue
2itbB00 4 201

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.25.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rcwB00 75.85 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 8 84 4.17 4.95
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2itbB00
IPEIDAFLGCPTPDAWIEAALADQETLLIDHKNCEFKAASTALSLIAKYNTHLDLINSRLAREELVHHEQVLRLKRRGVP
LRPVSAGRYASGLRRLVRAHEPVKLVDTLVVGAFIEARSCERFAALVPHLDEELGRFYHGLLKSEARHYQGYLKLAHNYG
DEADIARCVELVRAAEELIQSPDQELRFHSGIPQ    

Domain COMBS Sequence

>pdb|2itbB00
GXSLIPEIDAFLGCPTPDAWIEAALADQETLLIDHKNCEFKAASTALSLIAKYNTHLDLINXXSRLAREELVHHEQVLRL
XKRRGVPLRPVSAGRYASGLRRLVRAHEPVKLVDTLVVGAFIEARSCERFAALVPHLDEELGRFYHGLLKSEARHYQGYL
KLAHNYGDEADIARCVELVRAAEXELIQSPDQELRFHSGIPQALAA    

Domain History Events (12)

Domain assigned by auto on 14 Feb 2008 11:53

Assigning to "1.20.1260.10" based on similarity with "2itbA00"

Flow stage update by auto on 14 Feb 2008 11:29

No in_process hits for Domain "2itbB00" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2itbB00" hits Domain "2itbA00" (97.5728155339806% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2itbB00" hits Domain "2itbA00" (97.5728155339806% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2itbB00" hits Domain "2itbA00" (97.5728155339806% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2itbB00" hits Domain "2itbA00" (97.5728155339806% over 100%) which is currently in process

Update comment by auto on 30 Jul 2007 09:37

Domain "2itbB00" hits Domain "2itbA00" (97.5728155339806% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 09:30

Domain "2itbB00" hits Domain "2itbA00" (97.5728155339806% over 100%) which is currently in process

Flow stage update by auto on 30 Jul 2007 09:30

NW result present for Domain "2itbB00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2itbB00"

Flow stage update by auto on 10 Jul 2007 12:04

Beginning processing for Domain "2itbB00"

Insertion by cuff on 10 Jul 2007 10:51

nice chopping