CATH Domain: 2iojA00 XML data for domain: 2iojA00

Molscript image for 2iojA00
2iojA00
PDB coordinates for domain 2iojA00

PDB 2ioj, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1390 Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1
3.40.1390.20 Gene3D
3.40.1390.20.2
3.40.1390.20.2.1
3.40.1390.20.2.1.1
3.40.1390.20.2.1.1.1
3.40.1390.20.2.1.1.1.1

Segment boundaries for domain 2iojA00

Chopping figure for domain 2iojA00
DomainStart PDB ResidueStop PDB Residue
2iojA00 206 325

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.1390.20.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nmpA01 78.61 UPF0135 protein ybgIEscherichia coli K-12 3.40.1390.30 119 7 79 3.58 4.48
1knxA01 77.65 HPr kinase/phosphorylaseMycoplasma pneumoniaeHPr kinase/phosphorylase [EC:2.7.11.- 2.7.4.-] 3.40.1390.20 133 14 86 3.89 4.50
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2iojA00
GLSVEEIREAVSGEYLIEPREEKVEQVVIGASPQSALRYLREARNAALVTGGDRSDLLLTALEPNVRCLILTGNLEPVQL
VLTKAEERGVPVILTGHDTLTAVSRLESVFGRTRIRG    

Domain COMBS Sequence

>pdb|2iojA00
RNPVLAGLSVEEIREAVSGEYLIEPREEKXVEQVVIGAXSPQSALRYLREARNAALVTGGDRSDLLLTALEXPNVRCLIL
TGNLEPVQLVLTKAEERGVPVILTGHDTLTAVSRLESVFGRTRIRGEPKVGIXRELFES    

Domain History Events (12)

Domain assigned by auto on 12 Feb 2008 20:16

Assigning to "3.40.1390.20" based on similarity with "2iojB00"

Flow stage update by auto on 12 Feb 2008 20:05

No in_process hits for Domain "2iojA00" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2iojA00" hits Domain "2iojB00" (97.1223021582734% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2iojA00" hits Domain "2iojB00" (97.1223021582734% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2iojA00" hits Domain "2iojB00" (97.1223021582734% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2iojA00" hits Domain "2iojB00" (97.1223021582734% over 100%) which is currently in process

Update comment by auto on 29 Jul 2007 23:16

Domain "2iojA00" hits Domain "2iojB00" (97.1223021582734% over 100%) which is currently in process

Flow stage update by auto on 29 Jul 2007 23:08

Domain "2iojA00" hits Domain "2iojB00" (97.1223021582734% over 100%) which is currently in process

Flow stage update by auto on 29 Jul 2007 23:08

NW result present for Domain "2iojA00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2iojA00"

Flow stage update by auto on 10 Jul 2007 12:04

Beginning processing for Domain "2iojA00"

Insertion by auto on 10 Jul 2007 12:03

Final ChopClose added based on similarity with "2iojB"